Property Summary

NCBI Gene PubMed Count 22
Grant Count 4
Funding $144,352.75
PubMed Score 11.67
PubTator Score 11.27

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
malignant mesothelioma -3.100 0.000
glioblastoma -1.900 0.003
osteosarcoma 1.161 0.001
astrocytoma -1.300 0.009
atypical teratoid / rhabdoid tumor -2.000 0.000
medulloblastoma -1.300 0.000
medulloblastoma, large-cell -1.900 0.000
primitive neuroectodermal tumor -1.200 0.000
autosomal dominant Emery-Dreifuss muscul... 1.208 0.008
hereditary spastic paraplegia -1.078 0.018
Amyotrophic Lateral Sclerosis 1.277 0.000
lung cancer -1.600 0.000
Parkinson's disease -1.300 0.028
diabetes mellitus -1.300 0.002
pediatric high grade glioma -1.500 0.000
ovarian cancer -2.600 0.000

Synonym

Accession Q9UKA4 O75124 Q9NUK7 AKAP-11
Symbols PRKA11
AKAP-11
AKAP220
PPP1R44

Gene

PANTHER Protein Class (2)

Gene RIF (4)

PMID Text
26088133 Protein Kinase A Opposes the Phosphorylation-dependent Recruitment of Glycogen Synthase Kinase 3beta to A-kinase Anchoring Protein 220.
25188285 PKA compartmentalization via AKAP220 and AKAP12 contributes to endothelial barrier regulation.
21890631 AKAP220 protein organizes signaling elements that impact cell migration.
12147701 binds to glycogen synthase kinase-3beta (GSK-3beta) and mediates protein kinase A-dependent inhibition of GSK-3beta

AA Sequence

MATFRNNHMKTKASVRKSFSEDVFQSVKSLLQSQKELCSVTAEDCLQQDEHANLTEVTFLGFNEETDAAH      1 - 70
IQDLAAVSLELPDILNSLHFCSLNENEIICMKNINKPLDISSDPLNQSHPSGMLCVMRVSPTSPRLRIDF     71 - 140
IFSLLSKYATGIRYTLDTFLHQKHQLETTDEDDDDTNQSVSSIEDDFVTAFEHLEEEETSKPYNDGMNIT    141 - 210
VLRSQCDAASQTVTGHHLETHDLKILISSGQQKSLAKPSTSSVNVLGHKELPSVKTSVTTSISEPWTQRS    211 - 280
FYRSSNASDKDSDLQKTFFSSSPAYSSESECSSPSPVIFLDEEGYQKSLKAKLELPKIPVMKDDIEDSDS    281 - 350
EVSEFFDSFDQFDELEQTLETCLFNKDPVIGKSSQRKGHKHGKSCMNPQKFKFDRPALPANVRKPTPRKP    351 - 420
ESPYGNLCDAPDSPRPVKASREDSGLFSPIRSSAFSPLGGCTPAECFCQTDIGGDRIHENHDSVYYTYED    421 - 490
YAKSISCEVLGSVLRTHHTNTLSNINSIKHGENKTVTFKHGNLDQKNKSKNKSLMIKDSIQKFAADLVEK    491 - 560
SFGSAFKDLQKGVSSCTNALYHLAIKLTSSVLQMAFDELRRQRAFSLKERAISGLANFLVSEALSNALKD    561 - 630
LQYVKKQIFTNTVARFAADLAEELVFEGIMEVCQFSYPQTPASPQCGSFDFEDKVVKLYAKDLSESVIQE    631 - 700
AFIELSQVDVTFTTKAAVSVSTDNIKYVSAESVVPSTQAVTFSPSFHNQAIMVTKPVQEYKKEYTVQQAL    701 - 770
FCTSGIVTSIPVPLAGSALLPYHISSTACQAKAHLSSDDSNSNGDSAQVHIATKNREEKAACLRNICLPS    771 - 840
EHNPGNQNDFKPTNDDIEMQSSSKLPNDPAIISNFSAAVVHTIVNETLESMTSLEVTKMVDERTDYLTKS    841 - 910
LKEKTPPFSHCDQAVLQCSEASSNKDMFADRLSKSIIKHSIDKSKSVIPNIDKNAVYKESLPVSGEESQL    911 - 980
TPEKSPKFPDSQNQLTHCSLSAAKDCVPECKVSMVHGSSLETLPSCPAVTGQKSDLKESAKDQPLKKHNL    981 - 1050
NSTSLEALSFGQENPFPHSHTFSSTALTCVDGLHVEDKQKVRDRNVIPDTPPSTPLVPSRASSEWDIKKL   1051 - 1120
TKKLKGELAKEFAPATPPSTPHNSSVGSLSENEQNTIEKEEFMLKLMRSLSEEVESSESGELPEVDVKSE   1121 - 1190
HSGKKVQFAEALATHILSLATEMAASHLDNKIIQEPKVKNPCLNVQSQRSVSPTFLNPSDENLKTLCNFA   1191 - 1260
GDLAAEVITEAEKIAKVRNCMLFKQKKNSCYADGDEDYKVEEKLDIEAVVHPREVDPFILSLPPSSCMSG   1261 - 1330
LMYKYPSCESVTDEYAGHLIQILKQEGGNSELIMDQYANRLAYRSVKSGLQEAAKTTKVQCNSRMFPVPS   1331 - 1400
SQVKTNKELLMFSNKEHHQEADKKRQSKRNEGYFCKNQTCERTLDPYRNEVSQLYSFSTSLVHSITKDAK   1401 - 1470
EELTASLVGLPKSLTDSCLFEKSGYEEDNECHVTPELPKSLQPSSQNHRFYHSTGSLNGYGCGDNVVQAV   1471 - 1540
EQYAKKVVDDTLELTLGSTVFRVSETTKSADRVTYAEKLSPLTGQACRYCDLKELHNCTGNSSQHFFRQG   1541 - 1610
SLASSKPASNPKFSSRYQKSRIFHLSVPQIHVNLDKKAVLAEKIVAEAIEKAERELSSTSLAADSGIGQE   1611 - 1680
GASFAESLATETMTAAVTNVGHAVSSSKEIEDFQSTESVSSQQMNLSIGDDSTGSWSNLSFEDEHQDESS   1681 - 1750
SFHHLSESNGNSSSWSSLGLEGDLYEDNLSFPTSDSDGPDDKDEEHEDEVEGLGQDGKTLLITNIDMEPC   1751 - 1820
TVDPQLRIILQWLIASEAEVAELYFHDSANKEFMLLSKQLQEKGWKVGDLLQAVLQYYEVMEKASSEERC   1821 - 1890
KSLFDWLLENA                                                              1891 - 1901
//

Text Mined References (30)

PMID Year Title
26088133 2015 Protein Kinase A Opposes the Phosphorylation-dependent Recruitment of Glycogen Synthase Kinase 3? to A-kinase Anchoring Protein 220.
25188285 2014 PKA compartmentalization via AKAP220 and AKAP12 contributes to endothelial barrier regulation.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24249740 2014 Multistage genome-wide association meta-analyses identified two new loci for bone mineral density.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22504420 2012 Genome-wide meta-analysis identifies 56 bone mineral density loci and reveals 14 loci associated with risk of fracture.
21890631 2011 AKAP220 protein organizes signaling elements that impact cell migration.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
19801982 2009 Twenty bone-mineral-density loci identified by large-scale meta-analysis of genome-wide association studies.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
More...