Property Summary

NCBI Gene PubMed Count 18
PubMed Score 13.41
PubTator Score 9.01

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Leigh disease 100 0.0 5.0

Expression

  Differential Expression (6)

Disease log2 FC p
aldosterone-producing adenoma -1.138 9.3e-03
invasive ductal carcinoma -1.100 9.5e-05
malignant mesothelioma -1.500 4.1e-07
osteosarcoma -2.219 2.3e-07
ovarian cancer -1.600 8.7e-09
sonic hedgehog group medulloblastoma 1.200 5.1e-04

Gene RIF (6)

AA Sequence

MSPVFPMLTVLTMFYYICLRRRARTATRGEMMNTHRAIESNSQTSPLNAEVVQYAKEVVDFSSHYGSENS      1 - 70
MSYTMWNLAGVPNVFPSSGDFTQTAVFRTYGTWWDQCPSASLPFKRTPPNFQSQDYVELTFEQQVYPTAV     71 - 140
HVLETYHPGAVIRILACSANPYSPNPPAEVRWEILWSERPTKVNASQARQFKPCIKQINFPTNLIRLEVN    141 - 210
SSLLEYYTELDAVVLHGVKDKPVLSLKTSLIDMNDIEDDAYAEKDGCGMDSLNKKFSSAVLGEGPNNGYF    211 - 280
DKLPYELIQLILNHLTLPDLCRLAQTCKLLSQHCCDPLQYIHLNLQPYWAKLDDTSLEFLQSRCTLVQWL    281 - 350
NLSWTGNRGFISVAGFSRFLKVCGSELVRLELSCSHFLNETCLEVISEMCPNLQALNLSSCDKLPPQAFN    351 - 420
HIAKLCSLKRLVLYRTKVEQTALLSILNFCSELQHLSLGSCVMIEDYDVIASMIGAKCKKLRTLDLWRCK    421 - 490
NITENGIAELASGCPLLEELDLGWCPTLQSSTGCFTRLAHQLPNLQKLFLTANRSVCDTDIDELACNCTR    491 - 560
LQQLDILGTRMVSPASLRKLLESCKDLSLLDVSFCSQIDNRAVLELNASFPKVFIKKSFTQ             561 - 621
//

Text Mined References (17)

PMID Year Title