Property Summary

NCBI Gene PubMed Count 25
PubMed Score 17.54
PubTator Score 16.04

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
tuberculosis 1563 1.93160726355594E-8
ovarian cancer 8492 2.21512936470259E-7
malignant mesothelioma 3163 4.41309940503609E-6
cystic fibrosis 1670 3.10318181538521E-5
lung cancer 4473 6.77922757251387E-5
Multiple myeloma 1328 4.38961359020448E-4
psoriasis 6685 0.00224695343072114
medulloblastoma, large-cell 6234 0.00498149383917717
Waldenstrons macroglobulinemia 765 0.00674343971802195
invasive ductal carcinoma 2950 0.00684054149615694
Disease Target Count Z-score Confidence
Dental fluorosis 16 3.611 1.8

Expression

  Differential Expression (10)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.845 0.007
Multiple myeloma 1.374 0.000
malignant mesothelioma -1.100 0.000
psoriasis 1.100 0.002
cystic fibrosis -1.187 0.000
medulloblastoma, large-cell -1.400 0.005
tuberculosis 1.900 0.000
lung cancer -2.000 0.000
invasive ductal carcinoma -1.200 0.007
ovarian cancer -2.500 0.000

Synonym

Accession Q9UKA1 A8MSK4 B4DIB5 Q4W5A8 Q8NHP3 Q9NXN2 Q9P0I0 Q9P0X5 Q9UJT7 Q9UKC8
Symbols FBL4
FBL5
FLR1

Gene

PDB

3U9J   3U9M   3V5X   3V5Y   3V5Z  

  Ortholog (13)

Gene RIF (10)

PMID Text
25956243 FBXL5-mediated degradation of CITED2 leads to the activation of HIF-1alpha.
25832584 FBXL5 regulates cortactin through induction of its ubiquitylation, and FBXL5 similarly regulates Snail1.
24867096 Data suggest a mechanism for the negative regulation of cortactin by FBXL5 protein in gastric cancer cells migration.
24778179 results thus suggest that HERC2 regulates the basal turnover of FBXL5, and that this ubiquitin-dependent degradation pathway contributes to the control of mammalian iron metabolism
23135277 F-box and leucine-rich repeat protein 5 (FBXL5) is required for maintenance of cellular and systemic iron homeostasis
22648410 Data indicate that F-box and leucine-rich repeat protein 5 (FBXL5)-Hr (hemerythrin-like domain) undergoes substantive structural changes when iron becomes limiting, accounting for its switch-like behavior.
22253436 Detailed molecular and structural characterization of the ligand-responsive hemerythrin domain provides insights into the mechanisms by which FBXL5 serves as a unique mammalian metabolic sensor.
19762597 observations suggest a mechanistic link between iron sensing via the FBXL5 hemerythrin domain, IRP2 regulation, and cellular responses to maintain mammalian iron homeostasis
19762596 iron homeostasis is regulated by a proteolytic pathway that couples IRP2 degradation to intracellular iron levels through the stability and activity of FBXL5
17532294 Our findings provide a potential mechanism by which p150(Glued) protein function is regulated by SCFs.

AA Sequence

MAPFPEEVDVFTAPHWRMKQLVGLYCDKLSKTNFSNNNDFRALLQSLYATFKEFKMHEQIENEYIIGLLQ      1 - 70
QRSQTIYNVHSDNKLSEMLSLFEKGLKNVKNEYEQLNYAKQLKERLEAFTRDFLPHMKEEEEVFQPMLME     71 - 140
YFTYEELKDIKKKVIAQHCSQKDTAELLRGLSLWNHAEERQKFFKYSVDEKSDKEAEVSEHSTGITHLPP    141 - 210
EVMLSIFSYLNPQELCRCSQVSMKWSQLTKTGSLWKHLYPVHWARGDWYSGPATELDTEPDDEWVKNRKD    211 - 280
ESRAFHEWDEDADIDESEESAEESIAISIAQMEKRLLHGLIHNVLPYVGTSVKTLVLAYSSAVSSKMVRQ    281 - 350
ILELCPNLEHLDLTQTDISDSAFDSWSWLGCCQSLRHLDLSGCEKITDVALEKISRALGILTSHQSGFLK    351 - 420
TSTSKITSTAWKNKDITMQSTKQYACLHDLTNKGIGEEIDNEHPWTKPVSSENFTSPYVWMLDAEDLADI    421 - 490
EDTVEWRHRNVESLCVMETASNFSCSTSGCFSKDIVGLRTSVCWQQHCASPAFAYCGHSFCCTGTALRTM    491 - 560
SSLPESSAMCRKAARTRLPRGKDLIYFGSEKSDQETGRVLLFLSLSGCYQITDHGLRVLTLGGGLPYLEH    561 - 630
LNLSGCLTITGAGLQDLVSACPSLNDEYFYYCDNINGPHADTASGCQNLQCGFRACCRSGE             631 - 691
//

Text Mined References (28)

PMID Year Title
25956243 2015 FBXL5 modulates HIF-1? transcriptional activity by degradation of CITED2.
25832584 2015 FBXL5 inhibits metastasis of gastric cancer through suppressing Snail1.
25416956 2014 A proteome-scale map of the human interactome network.
24867096 2014 FBXL5 targets cortactin for ubiquitination-mediated destruction to regulate gastric cancer cell migration.
24778179 2014 HERC2 targets the iron regulator FBXL5 for degradation and modulates iron metabolism.
23135277 2013 F-box and leucine-rich repeat protein 5 (FBXL5) is required for maintenance of cellular and systemic iron homeostasis.
22648410 2012 Hemerythrin-like domain within F-box and leucine-rich repeat protein 5 (FBXL5) communicates cellular iron and oxygen availability by distinct mechanisms.
22492618 2012 The structural basis of iron sensing by the human F-box protein FBXL5.
22253436 2012 Structural and molecular characterization of iron-sensing hemerythrin-like domain within F-box and leucine-rich repeat protein 5 (FBXL5).
21516116 2011 Next-generation sequencing to generate interactome datasets.
More...