Property Summary

NCBI Gene PubMed Count 27
PubMed Score 20.63
PubTator Score 16.04

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Dental fluorosis 20 3.386 1.7

Expression

  Differential Expression (10)

Disease log2 FC p
cystic fibrosis -1.187 3.1e-05
invasive ductal carcinoma -1.200 6.8e-03
lung cancer -2.000 6.8e-05
malignant mesothelioma -1.100 4.4e-06
medulloblastoma, large-cell -1.100 7.3e-03
Multiple myeloma 1.374 4.4e-04
ovarian cancer -2.500 2.2e-07
psoriasis 1.100 2.2e-03
tuberculosis 1.100 4.2e-06
Waldenstrons macroglobulinemia 1.845 6.7e-03

 GWAS Trait (1)

Gene RIF (11)

AA Sequence

MAPFPEEVDVFTAPHWRMKQLVGLYCDKLSKTNFSNNNDFRALLQSLYATFKEFKMHEQIENEYIIGLLQ      1 - 70
QRSQTIYNVHSDNKLSEMLSLFEKGLKNVKNEYEQLNYAKQLKERLEAFTRDFLPHMKEEEEVFQPMLME     71 - 140
YFTYEELKDIKKKVIAQHCSQKDTAELLRGLSLWNHAEERQKFFKYSVDEKSDKEAEVSEHSTGITHLPP    141 - 210
EVMLSIFSYLNPQELCRCSQVSMKWSQLTKTGSLWKHLYPVHWARGDWYSGPATELDTEPDDEWVKNRKD    211 - 280
ESRAFHEWDEDADIDESEESAEESIAISIAQMEKRLLHGLIHNVLPYVGTSVKTLVLAYSSAVSSKMVRQ    281 - 350
ILELCPNLEHLDLTQTDISDSAFDSWSWLGCCQSLRHLDLSGCEKITDVALEKISRALGILTSHQSGFLK    351 - 420
TSTSKITSTAWKNKDITMQSTKQYACLHDLTNKGIGEEIDNEHPWTKPVSSENFTSPYVWMLDAEDLADI    421 - 490
EDTVEWRHRNVESLCVMETASNFSCSTSGCFSKDIVGLRTSVCWQQHCASPAFAYCGHSFCCTGTALRTM    491 - 560
SSLPESSAMCRKAARTRLPRGKDLIYFGSEKSDQETGRVLLFLSLSGCYQITDHGLRVLTLGGGLPYLEH    561 - 630
LNLSGCLTITGAGLQDLVSACPSLNDEYFYYCDNINGPHADTASGCQNLQCGFRACCRSGE             631 - 691
//

Text Mined References (30)

PMID Year Title