Property Summary

NCBI Gene PubMed Count 19
PubMed Score 37.25
PubTator Score 8.56

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
acute quadriplegic myopathy -1.114 1.7e-03
adult high grade glioma -1.100 1.5e-03
astrocytic glioma -1.200 3.3e-02
Astrocytoma, Pilocytic 1.100 2.1e-06
atypical teratoid / rhabdoid tumor -1.200 5.1e-04
Breast cancer -1.200 2.1e-15
Duchenne muscular dystrophy -1.412 1.9e-06
glioblastoma -1.200 6.9e-04
hereditary spastic paraplegia -1.143 1.3e-02
intraductal papillary-mucinous neoplasm ... 1.100 2.3e-02
limb girdle muscular dystrophy 2A -1.244 4.6e-04
malignant mesothelioma -1.200 4.7e-06
medulloblastoma, large-cell -1.100 6.5e-03
oligodendroglioma -1.200 3.0e-02
ovarian cancer -2.500 1.6e-07
spina bifida -1.903 4.7e-02
tuberculosis and treatment for 6 months 1.700 2.4e-05

Gene RIF (8)

AA Sequence

MAAMETETAPLTLESLPTDPLLLILSFLDYRDLINCCYVSRRLSQLSSHDPLWRRHCKKYWLISEEEKTQ      1 - 70
KNQCWKSLFIDTYSDVGRYIDHYAAIKKAWDDLKKYLEPRCPRMVLSLKEGAREEDLDAVEAQIGCKLPD     71 - 140
DYRCSYRIHNGQKLVVPGLLGSMALSNHYRSEDLLDVDTAAGGFQQRQGLKYCLPLTFCIHTGLSQYIAV    141 - 210
EAAEGRNKNEVFYQCPDQMARNPAAIDMFIIGATFTDWFTSYVKNVVSGGFPIIRDQIFRYVHDPECVAT    211 - 280
TGDITVSVSTSFLPELSSVHPPHYFFTYRIRIEMSKDALPEKACQLDSRYWRITNAKGDVEEVQGPGVVG    281 - 350
EFPIISPGRVYEYTSCTTFSTTSGYMEGYYTFHFLYFKDKIFNVAIPRFHMACPTFRVSIARLEMGPDEY    351 - 420
EEMEEEEEEEEEEDEDDDSADMDESDEDDEEERRRRVFDVPIRRRRCSRLF                       421 - 471
//

Text Mined References (22)

PMID Year Title