Property Summary

NCBI Gene PubMed Count 16
Grant Count 19
R01 Count 12
Funding $3,921,566.67
PubMed Score 35.86
PubTator Score 8.56

Knowledge Summary

Patent

No data available

Expression

Gene RIF (6)

PMID Text
25721664 Fbxo3 promotes the proteasomal degradation of Smurf1. Fbxo3 promotes the poly-ubiquitination of Smurf1.
24403578 Virulence factor NSs of rift valley fever virus recruits the FBXO3 to degrade subunit p62 of general transcription factor TFIIH.
23542741 controls TRAF adaptor stability to regulate inflammation
22190034 HIV-1 Tat is identified to have a physical interaction with F-box protein 3 (FBXO3) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18809579 Fbx3 formed SCF(Fbx3) ubiquitin ligase and promoted the degradation of HIPK2 and p300 by the ubiquitin-proteasome pathway

AA Sequence

MAAMETETAPLTLESLPTDPLLLILSFLDYRDLINCCYVSRRLSQLSSHDPLWRRHCKKYWLISEEEKTQ      1 - 70
KNQCWKSLFIDTYSDVGRYIDHYAAIKKAWDDLKKYLEPRCPRMVLSLKEGAREEDLDAVEAQIGCKLPD     71 - 140
DYRCSYRIHNGQKLVVPGLLGSMALSNHYRSEDLLDVDTAAGGFQQRQGLKYCLPLTFCIHTGLSQYIAV    141 - 210
EAAEGRNKNEVFYQCPDQMARNPAAIDMFIIGATFTDWFTSYVKNVVSGGFPIIRDQIFRYVHDPECVAT    211 - 280
TGDITVSVSTSFLPELSSVHPPHYFFTYRIRIEMSKDALPEKACQLDSRYWRITNAKGDVEEVQGPGVVG    281 - 350
EFPIISPGRVYEYTSCTTFSTTSGYMEGYYTFHFLYFKDKIFNVAIPRFHMACPTFRVSIARLEMGPDEY    351 - 420
EEMEEEEEEEEEEDEDDDSADMDESDEDDEEERRRRVFDVPIRRRRCSRLF                       421 - 471
//

Publication (19)

PMID Year Title
25721664 2015 F-box protein Fbxo3 targets Smurf1 ubiquitin ligase for ubiquitination and degradation.
24403578 2014 Virulence factor NSs of rift valley fever virus recruits the F-box protein FBXO3 to degrade subunit p62 of general transcription factor TFIIH.
23870195 2013 Genetics of coronary artery calcification among African Americans, a meta-analysis.
23542741 2013 A combinatorial F box protein directed pathway controls TRAF adaptor stability to regulate inflammation.
22632967 2012 Cyclin F-mediated degradation of ribonucleotide reductase M2 controls genome integrity and DNA repair.
22190034 2011 Global landscape of HIV-human protein complexes.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21269460 2011 Initial characterization of the human central proteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19028597 2009 Maturation of human dendritic cells is accompanied by functional remodelling of the ubiquitin-proteasome system.
More...