Property Summary

NCBI Gene PubMed Count 14
PubMed Score 2.33
PubTator Score 2.12

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
active ulcerative colitis -1.059 9.0e-03
adult high grade glioma 1.100 1.3e-03
astrocytic glioma 1.300 3.3e-03
Astrocytoma, Pilocytic 1.100 2.5e-03
atypical teratoid / rhabdoid tumor -1.100 1.5e-05
Breast cancer -1.100 1.6e-09
cutaneous lupus erythematosus -1.100 3.7e-03
cystic fibrosis -1.600 2.7e-05
dermatomyositis 1.300 2.0e-04
ependymoma 1.100 2.2e-02
glioblastoma -1.700 3.2e-06
group 3 medulloblastoma 1.100 3.4e-02
intraductal papillary-mucinous neoplasm ... 1.100 1.3e-02
invasive ductal carcinoma -1.400 2.9e-02
medulloblastoma, large-cell -1.500 1.2e-04
Multiple myeloma 1.210 4.6e-03
non primary Sjogren syndrome sicca -1.100 1.8e-02
non-small cell lung cancer -1.456 4.5e-17
osteosarcoma -1.490 4.9e-03
ovarian cancer -1.900 8.4e-09
Pick disease -1.300 1.0e-04
psoriasis 1.300 2.2e-03
Rheumatoid arthritis 1.400 1.2e-02
Waldenstrons macroglobulinemia 1.424 6.1e-03

Protein-protein Interaction (1)

Gene RIF (1)

AA Sequence

MPDIIWVFPPQAEAEEDCHSDTVRADDDEENESPAETDLQAQLQMFRAQWMFELAPGVSSSNLENRPCRA      1 - 70
ARGSLQKTSADTKGKQEQAKEEKARELFLKAVEEEQNGALYEAIKFYRRAMQLVPDIEFKITYTRSPDGD     71 - 140
GVGNSYIEDNDDDSKMADLLSYFQQQLTFQESVLKLCQPELESSQIHISVLPMEVLMYIFRWVVSSDLDL    141 - 210
RSLEQLSLVCRGFYICARDPEIWRLACLKVWGRSCIKLVPYTSWREMFLERPRVRFDGVYISKTTYIRQG    211 - 280
EQSLDGFYRAWHQVEYYRYIRFFPDGHVMMLTTPEEPQSIVPRLRTRNTRTDAILLGHYRLSQDTDNQTK    281 - 350
VFAVITKKKEEKPLDYKYRYFRRVPVQEADQSFHVGLQLCSSGHQRFNKLIWIHHSCHITYKSTGETAVS    351 - 420
AFEIDKMYTPLFFARVRSYTAFSERPL                                               421 - 447
//

Text Mined References (18)

PMID Year Title