Property Summary

NCBI Gene PubMed Count 15
Grant Count 4
R01 Count 4
Funding $419,370.66
PubMed Score 3.28
PubTator Score 2.12

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
psoriasis 6,683

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.100 0.000

Synonym

Accession Q9UK96 Q08AL3 Q08AL4 Q5JRT8 Q9UKC3
Symbols FBX10
PRMT11

Gene

PANTHER Protein Class (2)

Gene RIF (6)

PMID Text
26187670 siRNA-mediated knockdown of FBXO11 facilitated HIF-1alpha expression in various cancer cells and HIF-1alpha-driven gene expressions, but the FBXO10 knockdown did not.
23431138 FBXO10, a protein related to DRE-1, binds BCL2 and promotes its degradation, thereby initiating cell death. Moreover, some diffuse large B-cell lymphomas have inactivating mutations in FBXO10 or express FBXO10 at low levels.
23138933 Higher Fbxo10 expression in T cells is associated with Mcs5a increased susceptibility alleles
20554749 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19124506 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MEAGGLPLELWRMILAYLHLPDLGRCSLVCRAWYELILSLDSTRWRQLCLGCTECRHPNWPNQPDVEPES      1 - 70
WREAFKQHYLASKTWTKNALDLESSICFSLFRRRRERRTLSVGPGREFDSLGSALAMASLYDRIVLFPGV     71 - 140
YEEQGEIILKVPVEIVGQGKLGEVALLASIDQHCSTTRLCNLVFTPAWFSPIMYKTTSGHVQFDNCNFEN    141 - 210
GHIQVHGPGTCQVKFCTFKNTHIFLHNVPLCVLENCEFVGSENNSVTVEGHPSADKNWAYKYLLGLIKSS    211 - 280
PTFLPTEDSDFLMSLDLESRDQAWSPKTCDIVIEGSQSPTSPASSSPKPGSKAGSQEAEVGSDGERVAQT    281 - 350
PDSSDGGLSPSGEDEDEDQLMYRLSYQVQGPRPVLGGSFLGPPLPGASIQLPSCLVLNSLQQELQKDKEA    351 - 420
MALANSVQGCLIRKCLFRDGKGGVFVCSHGRAKMEGNIFRNLTYAVRCIHNSKIIMLRNDIYRCRASGIF    421 - 490
LRLEGGGLIAGNNIYHNAEAGVDIRKKSNPLILCNQIHHGLRSGIVVLGNGKGIIRNNQIFSNKEAGIYI    491 - 560
LYHGNPVVSGNHIFKGRAAGIAVNENGKGLITENVIRENQWGGVDIRRGGIPVLRSNLICFGYSDGVVVG    561 - 630
DEGKGLIEGNTIYANKGCGVWMMSSSLPHVTSNHVSYNGLYGVAVFSQKDGSSELPRGHRAQENFSEDGD    631 - 700
AILWETELEKEDDPLRRPITIALVESNSINHNGASGLYVQSSEALHVITNVIHANGDRGITVAQSSQPTR    701 - 770
VANNSISCNRQSGVKVEAQCKVELRGNGIYDNRGHGIITKGDSTIVIENDIIGNRGSGLQLLPRSDTKVI    771 - 840
KNRIHSFRAYGIAVRGRAKALVQENIIFQGKTSKTIFQQISNNRECIMQNNKFLVFKKKSDTWRLVNPPA    841 - 910
RPHLENSLRRPSAAHNGQKVTAMATRITARVEGGYHSNRSVFCTIL                            911 - 956
//

Publication (17)

PMID Year Title
26187670 2015 FBXO11 represses cellular response to hypoxia by destabilizing hypoxia-inducible factor-1? mRNA.
24613396 2014 DRE-1/FBXO11-dependent degradation of BLMP-1/BLIMP-1 governs C. elegans developmental timing and maturation.
23431138 2013 Related F-box proteins control cell death in Caenorhabditis elegans and human lymphoma.
23138933 2014 Human MCS5A1 candidate breast cancer susceptibility gene FBXO10 is induced by cellular stress and correlated with lens epithelium-derived growth factor (LEDGF).
20554749 2010 FGFR2 and other loci identified in genome-wide association studies are associated with breast cancer in African-American and younger women.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19300908 2009 The protein arginine methyltransferase family: an update about function, new perspectives and the physiological role in humans.
19124506 2009 Common genetic variation in candidate genes and susceptibility to subtypes of breast cancer.
15520277 2004 Systematic analysis and nomenclature of mammalian F-box proteins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...