Property Summary

NCBI Gene PubMed Count 15
Grant Count 1
Funding $65,763.9
PubMed Score 43.63
PubTator Score 38.71

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (3)

Disease log2 FC p
malignant mesothelioma 1.100 0.000
lung cancer 2.100 0.000
ovarian cancer 1.700 0.000

Synonym

Accession Q9UK80 Q59H60 Q5BKT5 Q5VTW9 Q5VTX0 Q9BTV1 Q9HBS2 Q9NYN4
Symbols USP16
USP23

Gene

 Grant Application (1)

PDB

2Y5B   3I3T   3MTN  

Gene RIF (6)

PMID Text
26100909 Data show that SUMOylated BANP, E5R, and Nac1 (BEN) domain 3 (BEND3) stabilizes NoRC component TTF-1-interacting protein 5 (Tip5)via association with ubiquitin specific protease 21 (USP21) debiquitinase
25197364 The protein stability of IL-33 is maintained by USP21 through deubiquitination
23395819 Identification of the E3 deubiquitinase ubiquitin-specific peptidase 21 (USP21) as a positive regulator of the transcription factor GATA3
22298430 Study observed a reduction in the number of A549 cells developing a primary cilium upon serum starvation when USP21 was depleted with two independent siRNA oligos.
21399617 Study report that USP21 cleaves Ub polymers, and with reduced activity also targets ISG15, but is inactive against NEDD8.
19910467 USP21 plays an important role in the down-regulation of TNFalpha-induced NF-kappaB activation through deubiquitinating RIP1.

AA Sequence

MPQASEHRLGRTREPPVNIQPRVGSKLPFAPRARSKERRNPASGPNPMLRPLPPRPGLPDERLKKLELGR      1 - 70
GRTSGPRPRGPLRADHGVPLPGSPPPTVALPLPSRTNLARSKSVSSGDLRPMGIALGGHRGTGELGAALS     71 - 140
RLALRPEPPTLRRSTSLRRLGGFPGPPTLFSIRTEPPASHGSFHMISARSSEPFYSDDKMAHHTLLLGSG    141 - 210
HVGLRNLGNTCFLNAVLQCLSSTRPLRDFCLRRDFRQEVPGGGRAQELTEAFADVIGALWHPDSCEAVNP    211 - 280
TRFRAVFQKYVPSFSGYSQQDAQEFLKLLMERLHLEINRRGRRAPPILANGPVPSPPRRGGALLEEPELS    281 - 350
DDDRANLMWKRYLEREDSKIVDLFVGQLKSCLKCQACGYRSTTFEVFCDLSLPIPKKGFAGGKVSLRDCF    351 - 420
NLFTKEEELESENAPVCDRCRQKTRSTKKLTVQRFPRILVLHLNRFSASRGSIKKSSVGVDFPLQRLSLG    421 - 490
DFASDKAGSPVYQLYALCNHSGSVHYGHYTALCRCQTGWHVYNDSRVSPVSENQVASSEGYVLFYQLMQE    491 - 560
PPRCL                                                                     561 - 565
//

Text Mined References (20)

PMID Year Title
26100909 2015 BEND3 represses rDNA transcription by stabilizing a NoRC component via USP21 deubiquitinase.
25416956 2014 A proteome-scale map of the human interactome network.
25197364 2014 Deubiquitination and stabilization of IL-33 by USP21.
23395819 2013 Identification of the E3 deubiquitinase ubiquitin-specific peptidase 21 (USP21) as a positive regulator of the transcription factor GATA3.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22298430 2012 Systematic survey of deubiquitinase localization identifies USP21 as a regulator of centrosome- and microtubule-associated functions.
21888622 2012 A global survey of CRM1-dependent nuclear export sequences in the human deubiquitinase family.
21399617 2011 Polyubiquitin binding and cross-reactivity in the USP domain deubiquitinase USP21.
19910467 2010 Ubiquitin-specific peptidase 21 inhibits tumor necrosis factor alpha-induced nuclear factor kappaB activation via binding to and deubiquitinating receptor-interacting protein 1.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
More...