Property Summary

NCBI Gene PubMed Count 13
PubMed Score 328.17
PubTator Score 151.40

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
psoriasis 6685 2.89445434604405E-47
breast carcinoma 1614 1.56196404675828E-27
non-small cell lung cancer 2798 1.40919406607877E-25
lung adenocarcinoma 2714 9.43074288804387E-9
group 4 medulloblastoma 1875 8.22957008003441E-6
lung cancer 4473 3.41377966859358E-5
ovarian cancer 8492 1.34114699083892E-4
invasive ductal carcinoma 2950 1.39074462689737E-4
acute quadriplegic myopathy 1157 1.96610562274802E-4
glioblastoma 5572 2.22616658769244E-4
ductal carcinoma in situ 1745 4.87982520459233E-4
primitive neuroectodermal tumor 3031 5.77382503673464E-4
medulloblastoma, large-cell 6234 0.00119108952915432
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00141839940312641
osteosarcoma 7933 0.00205146058878854
inflammatory breast cancer 404 0.00217862246432972
cutaneous lupus erythematosus 1056 0.00247837354773726
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00490155161834805
pancreatic cancer 2300 0.00559179046572847
primary pancreatic ductal adenocarcinoma 1271 0.00744782824772355
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00814684563321638
Pick disease 1893 0.00863570394569358
diabetes mellitus 1663 0.0145539962911426
non primary Sjogren syndrome sicca 840 0.0165484109701592

Expression

Synonym

Accession Q9UK76 B2R6K3 Q53FG7 Q7Z2D2 Q7Z2F0
Symbols ARM2
HN1A

Gene

HN1

Gene RIF (5)

PMID Text
25450365 miR-132 is significantly down-regulated in breast cancer tissues and cancer cell lines. Additional study identifies HN1 as a novel direct target of miR-132. MiR-132 down-regulates HN1 expression by binding to the 3' UTR of HN1.
25169422 Data report that HN1 is an essential factor for beta-catenin turnover and signaling, augments cell growth and migration in prostate cancer cells.
22155408 HN1 maintains a balance between the androgen-regulated nuclear translocation of androgen receptor and steady-state Akt phosphorylation, predominantly in the absence of androgens.
21323578 EGF and kinase inhibitors increase HN1 expression, and Silencing of HN1 results in cell cycle alterations in prostate cells.
19145478 These data suggest a role for Hn1 in the biology of malignant brain tumors.

AA Sequence

MTTTTTFKGVDPNSRNSSRVLRPPGGGSNFSLGFDEPTEQPVRKNKMASNIFGTPEENQASWAKSAGAKS      1 - 70
SGGREDLESSGLQRRNSSEASSGDFLDLKGEGDIHENVDTDLPGSLGQSEEKPVPAAPVPSPVAPAPVPS     71 - 140
RRNPPGGKSSLVLG                                                            141 - 154
//

Text Mined References (26)

PMID Year Title
25450365 2014 MiR-132 prohibits proliferation, invasion, migration, and metastasis in breast cancer by targeting HN1.
25169422 2015 HN1 negatively influences the ?-catenin/E-cadherin interaction, and contributes to migration in prostate cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22155408 2012 Androgen regulated HN1 leads proteosomal degradation of androgen receptor (AR) and negatively influences AR mediated transactivation in prostate cells.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21323578 2011 Ubiquitously expressed hematological and neurological expressed 1 downregulates Akt-mediated GSK3? signaling, and its knockdown results in deregulated G2/M transition in prostate cells.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
More...