Property Summary

NCBI Gene PubMed Count 14
PubMed Score 338.39
PubTator Score 151.40

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Gene RIF (5)

AA Sequence

MTTTTTFKGVDPNSRNSSRVLRPPGGGSNFSLGFDEPTEQPVRKNKMASNIFGTPEENQASWAKSAGAKS      1 - 70
SGGREDLESSGLQRRNSSEASSGDFLDLKGEGDIHENVDTDLPGSLGQSEEKPVPAAPVPSPVAPAPVPS     71 - 140
RRNPPGGKSSLVLG                                                            141 - 154
//

Text Mined References (27)

PMID Year Title