Property Summary

NCBI Gene PubMed Count 17
PubMed Score 17.01
PubTator Score 9.66

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
Breast cancer 3099 3.9815047516129E-15
juvenile dermatomyositis 1189 8.66799276350261E-11
acute quadriplegic myopathy 1157 6.7386686511475E-8
hepatocellular carcinoma 550 2.01355436938423E-6
tuberculosis and treatment for 6 months 686 1.07629200380259E-5
malignant mesothelioma 3163 1.13697947853482E-5
atypical teratoid / rhabdoid tumor 4369 1.40594955085873E-5
glioblastoma 5572 3.06337164954725E-5
ovarian cancer 8492 3.50986613851308E-4
gastric cancer 436 8.05319216889855E-4
medulloblastoma, large-cell 6234 0.00133742653081055
dermatomyositis 967 0.00208123168422824
adult high grade glioma 2148 0.0028462356952315
group 4 medulloblastoma 1875 0.00354809467633852
pancreatic carcinoma 567 0.0071424966265643
pancreatic cancer 2300 0.00714249662656431
Multiple myeloma 1328 0.0168445458162973
colon cancer 1475 0.0442550124018876
astrocytic glioma 2241 0.0498818756897966

Expression

  Differential Expression (19)

Disease log2 FC p
gastric cancer 1.500 0.001
hepatocellular carcinoma 1.800 0.000
pancreatic cancer 1.300 0.007
Multiple myeloma 1.234 0.017
malignant mesothelioma 1.100 0.000
astrocytic glioma -1.100 0.050
atypical teratoid / rhabdoid tumor -1.600 0.000
glioblastoma -1.400 0.000
medulloblastoma, large-cell -1.300 0.001
juvenile dermatomyositis 1.399 0.000
acute quadriplegic myopathy 2.097 0.000
tuberculosis and treatment for 6 months 1.900 0.000
colon cancer -1.700 0.044
adult high grade glioma -1.100 0.003
group 4 medulloblastoma 1.100 0.004
pancreatic carcinoma 1.300 0.007
Breast cancer -1.300 0.000
ovarian cancer 1.200 0.000
dermatomyositis 1.600 0.002

Synonym

Accession Q9UK73 O43146 FEM1b
Symbols F1AA
F1A-ALPHA
FEM1-beta

Gene

  Ortholog (13)

Gene RIF (7)

PMID Text
24076122 These findings have implications for understanding the cellular functions of Fem1b, and the regulation of Gli1 oncoprotein activity.
20200332 Observational study of gene-disease association. (HuGE Navigator)
19948975 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and genetic testing. (HuGE Navigator)
19908242 the proapoptotic protein Fem1b is downregulated by the proteasome in malignant colon cancer cells and mediates proteasome inhibitor-induced apoptosis of these cells
19330022 FEM1B is required for Rad9 recruitment and CHK1 activation in response to replication stress.
18757445 This study presents evidence suggesting a role for FEM1A and FEM1B in the pathogenesis of polycystic ovary syndrome. Only FEM1B variants were associated with insulin-related traits in PCOS women.
18757445 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MEGLAGYVYKAASEGKVLTLAALLLNRSESDIRYLLGYVSQQGGQRSTPLIIAARNGHAKVVRLLLEHYR      1 - 70
VQTQQTGTVRFDGYVIDGATALWCAAGAGHFEVVKLLVSHGANVNHTTVTNSTPLRAACFDGRLDIVKYL     71 - 140
VENNANISIANKYDNTCLMIAAYKGHTDVVRYLLEQRADPNAKAHCGATALHFAAEAGHIDIVKELIKWR    141 - 210
AAIVVNGHGMTPLKVAAESCKADVVELLLSHADCDRRSRIEALELLGASFANDRENYDIIKTYHYLYLAM    211 - 280
LERFQDGDNILEKEVLPPIHAYGNRTECRNPQELESIRQDRDALHMEGLIVRERILGADNIDVSHPIIYR    281 - 350
GAVYADNMEFEQCIKLWLHALHLRQKGNRNTHKDLLRFAQVFSQMIHLNETVKAPDIECVLRCSVLEIEQ    351 - 420
SMNRVKNISDADVHNAMDNYECNLYTFLYLVCISTKTQCSEEDQCKINKQIYNLIHLDPRTREGFTLLHL    421 - 490
AVNSNTPVDDFHTNDVCSFPNALVTKLLLDCGAEVNAVDNEGNSALHIIVQYNRPISDFLTLHSIIISLV    491 - 560
EAGAHTDMTNKQNKTPLDKSTTGVSEILLKTQMKMSLKCLAARAVRANDINYQDQIPRTLEEFVGFH       561 - 627
//

Text Mined References (21)

PMID Year Title
24076122 2013 Fem1b promotes ubiquitylation and suppresses transcriptional activity of Gli1.
23377640 2013 Common genetic variation and antidepressant efficacy in major depressive disorder: a meta-analysis of three genome-wide pharmacogenetic studies.
20200332 2010 Family-based analysis of candidate genes for polycystic ovary syndrome.
19948975 2009 Integrative predictive model of coronary artery calcification in atherosclerosis.
19908242 2010 Fem1b, a proapoptotic protein, mediates proteasome inhibitor-induced apoptosis of human colon cancer cells.
19330022 2009 Human FEM1B is required for Rad9 recruitment and CHK1 activation in response to replication stress.
18757445 2008 FEM1A and FEM1B: novel candidate genes for polycystic ovary syndrome.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17003112 2006 Posttranslational hydroxylation of ankyrin repeats in IkappaB proteins by the hypoxia-inducible factor (HIF) asparaginyl hydroxylase, factor inhibiting HIF (FIH).
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
More...