Property Summary

NCBI Gene PubMed Count 14
PubMed Score 26.86
PubTator Score 14.71

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Amyotrophic Lateral Sclerosis 432
Disease Target Count P-value
glioblastoma 5572 1.45944931700604E-8
osteosarcoma 7933 7.89204300568943E-6
pediatric high grade glioma 2712 1.48011799878399E-5
pilocytic astrocytoma 3086 1.55131492228354E-5
sonic hedgehog group medulloblastoma 1482 1.8412221689642E-5
atypical teratoid/rhabdoid tumor 1095 4.90046368996183E-5
posterior fossa group A ependymoma 1511 4.9775961644753E-5
hepatocellular carcinoma 550 3.27330610513354E-4
primitive neuroectodermal tumor 3031 4.82314564794989E-4
pituitary cancer 1972 0.0061793843028795
ovarian cancer 8492 0.0109769735235743
Disease Target Count Z-score Confidence
Subacute thyroiditis 5 3.611 1.8

Expression

  Differential Expression (11)

Synonym

Accession Q9UK59 Q96GH0 Q9NXQ6
Symbols

Gene

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA Inparanoid
Fruitfly OMA Inparanoid
S.cerevisiae EggNOG Inparanoid

Gene RIF (3)

PMID Text
25671812 Results of protein-protein interaction between human Dbr1 and factors found in the Intron Large complex identify Xab2 and a novel protein CWF19L1 as specific interactors of DBR1.
24672043 Inhibition of DBR1 caused a significant reduction in the formation of intermediate and full-length HIV-1 cDNA.
1850323 Dbr1 protein cleaves the 2'-5' phosphodiester bond of intron lariats, necessary for subsequent intron degradation that follows pre-mRNA splicing.

AA Sequence

MRVAVAGCCHGELDKIYETLALAERRGPGPVDLLLCCGDFQAVRNEADLRCMAVPPKYRHMQTFYRYYSG      1 - 70
EKKAPVLTLFIGGNHEASNHLQELPYGGWVAPNIYYLGLAGVVKYRGVRIGGISGIFKSHDYRKGHFECP     71 - 140
PYNSSTIRSIYHVRNIEVYKLKQLKQPIDIFLSHDWPRSIYHYGNKKQLLKTKSFFRQEVENNTLGSPAA    141 - 210
SELLEHLKPTYWFSAHLHVKFAALMQHQAKDKGQTARATKFLALDKCLPHRDFLQILEIEHDPSAPDYLE    211 - 280
YDIEWLTILRATDDLINVTGRLWNMPENNGLHARWDYSATEEGMKEVLEKLNHDLKVPCNFSVTAACYDP    281 - 350
SKPQTQMQLIHRINPQTTEFCAQLGIIDINVRLQKSKEEHHVCGEYEEQDDVESNDSGEDQSEYNTDTSA    351 - 420
LSSINPDEIMLDEEEDEDSIVSAHSGMNTPSVEPSDQASEFSASFSDVRILPGSMIVSSDDTVDSTIDRE    421 - 490
GKPGGTVESGNGEDLTKVPLKRLSDEHEPEQRKKIKRRNQAIYAAVDDDDDDAA                    491 - 544
//

Text Mined References (21)

PMID Year Title
25671812 2015 Identification of the specific interactors of the human lariat RNA debranching enzyme 1 protein.
24672043 2014 Impairment of HIV-1 cDNA synthesis by DBR1 knockdown.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
More...