Property Summary

NCBI Gene PubMed Count 17
PubMed Score 29.77
PubTator Score 14.71

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma 1.500 1.8e-03
Astrocytoma, Pilocytic 1.400 1.9e-05
atypical teratoid/rhabdoid tumor 1.400 4.9e-05
glioblastoma 1.600 1.5e-08
group 3 medulloblastoma 1.600 1.1e-02
hepatocellular carcinoma 1.200 3.3e-04
osteosarcoma -1.732 7.9e-06
ovarian cancer 1.200 1.1e-02
pituitary cancer 1.100 6.2e-03
posterior fossa group A ependymoma 1.200 5.0e-05
primitive neuroectodermal tumor 1.300 4.8e-04

Gene RIF (6)

AA Sequence

MRVAVAGCCHGELDKIYETLALAERRGPGPVDLLLCCGDFQAVRNEADLRCMAVPPKYRHMQTFYRYYSG      1 - 70
EKKAPVLTLFIGGNHEASNHLQELPYGGWVAPNIYYLGLAGVVKYRGVRIGGISGIFKSHDYRKGHFECP     71 - 140
PYNSSTIRSIYHVRNIEVYKLKQLKQPIDIFLSHDWPRSIYHYGNKKQLLKTKSFFRQEVENNTLGSPAA    141 - 210
SELLEHLKPTYWFSAHLHVKFAALMQHQAKDKGQTARATKFLALDKCLPHRDFLQILEIEHDPSAPDYLE    211 - 280
YDIEWLTILRATDDLINVTGRLWNMPENNGLHARWDYSATEEGMKEVLEKLNHDLKVPCNFSVTAACYDP    281 - 350
SKPQTQMQLIHRINPQTTEFCAQLGIIDINVRLQKSKEEHHVCGEYEEQDDVESNDSGEDQSEYNTDTSA    351 - 420
LSSINPDEIMLDEEEDEDSIVSAHSGMNTPSVEPSDQASEFSASFSDVRILPGSMIVSSDDTVDSTIDRE    421 - 490
GKPGGTVESGNGEDLTKVPLKRLSDEHEPEQRKKIKRRNQAIYAAVDDDDDDAA                    491 - 544
//

Text Mined References (24)

PMID Year Title