Property Summary

NCBI Gene PubMed Count 28
Grant Count 5
R01 Count 5
Funding $135,384.57
PubMed Score 6.65
PubTator Score 21.90

Knowledge Summary

Patent

No data available

Expression

Gene RIF (14)

PMID Text
26043836 CCNL1 is the target gene of miR-199b-5p.
22685556 Data indicate that if the newborn carried a risk allele rs900400 near LEKR/CCNL1, the impact of stress on birth size was stronger.
22073261 birth weight lowering effect of the C-allele of rs900400 located near LEKR1 and CCNL1 was replicated in the Danish population. Furthermore the C-allele was associated with increased insulin response following oral glucose stimulation
21712988 Data show low birth weight in Asian Indians is not due to variation near CCNL1/ADCY5, but variant ADCY5 is associated with elevated glucose/decreased insulin response which suggests a common genetic cause of low birth weight and risk of type 2 diabetes.
21586274 These data demonstrate that there is a fine balance between CCNL1 and TIMP1, which may contribute to breast cancer development.
21307140 Our results suggest that a genetic variant of ccnl1 leads to symmetric growth restriction from early pregnancy onward
20721974 Cyclin L1 amplification is associated with uterine cervical carcinoma.
20372150 variants in ADCY5 and near CCNL1 are associated with fetal growth and birth weight
18216018 CDK11(p110) interacts physically and functionally with cyclin Lalpha and -beta isoforms and SR proteins to regulate splicing.
17494991 Data show that a green fluorescent protein (GFP) fusion protein of cyclin L1, in contrast to cyclin L2, was not mobile within the nucleus of living COS7 cells.
More...

AA Sequence

MASGPHSTATAAAAASSAAPSAGGSSSGTTTTTTTTTGGILIGDRLYSEVSLTIDHSLIPEERLSPTPSM      1 - 70
QDGLDLPSETDLRILGCELIQAAGILLRLPQVAMATGQVLFHRFFYSKSFVKHSFEIVAMACINLASKIE     71 - 140
EAPRRIRDVINVFHHLRQLRGKRTPSPLILDQNYINTKNQVIKAERRVLKELGFCVHVKHPHKIIVMYLQ    141 - 210
VLECERNQTLVQTAWNYMNDSLRTNVFVRFQPETIACACIYLAARALQIPLPTRPHWFLLFGTTEEEIQE    211 - 280
ICIETLRLYTRKKPNYELLEKEVEKRKVALQEAKLKAKGLNPDGTPALSTLGGFSPASKPSSPREVKAEE    281 - 350
KSPISINVKTVKKEPEDRQQASKSPYNGVRKDSKRSRNSRSASRSRSRTRSRSRSHTPRRHYNNRRSRSG    351 - 420
TYSSRSRSRSRSHSESPRRHHNHGSPHLKAKHTRDDLKSSNRHGHKRKKSRSRSQSKSRDHSDAAKKHRH    421 - 490
ERGHHRDRRERSRSFERSHKSKHHGGSRSGHGRHRR                                      491 - 526
//

Publication (38)

PMID Year Title
26043836 2015 Overexpression of miR?199b?5p inhibits Ewing's sarcoma cell lines by targeting CCNL1.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25416956 2014 A proteome-scale map of the human interactome network.
25231870 2014 Parent-of-origin-specific allelic associations among 106 genomic loci for age at menarche.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23575227 2013 The chromosome 3q25 genomic region is associated with measures of adiposity in newborns in a multi-ethnic genome-wide association study.
23202124 2013 New loci associated with birth weight identify genetic links between intrauterine growth and adult height and metabolism.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22911880 2012 Genome-wide association analysis of eating disorder-related symptoms, behaviors, and personality traits.
22685556 2012 The interplay of variants near LEKR and CCNL1 and social stress in relation to birth size.
More...