Property Summary

NCBI Gene PubMed Count 29
PubMed Score 6.96
PubTator Score 21.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
acute myeloid leukemia 1.100 9.1e-03
acute quadriplegic myopathy 1.357 2.5e-04
autosomal dominant Emery-Dreifuss muscul... 1.146 2.5e-02
Breast cancer -1.100 3.7e-12
diabetes mellitus -1.300 4.3e-02
ependymoma 1.300 2.7e-02
glioblastoma 1.600 3.0e-03
group 3 medulloblastoma 1.100 1.0e-02
hepatocellular carcinoma -1.100 2.1e-02
interstitial lung disease -1.300 4.4e-02
intraductal papillary-mucinous neoplasm ... 1.300 1.4e-03
invasive ductal carcinoma 1.100 5.6e-03
lung cancer -1.400 3.9e-04
non-small cell lung cancer -1.013 5.5e-11
ovarian cancer -1.300 7.2e-06
pancreatic ductal adenocarcinoma liver m... 1.351 2.6e-02
Pick disease -2.200 1.2e-06
pituitary cancer -1.400 6.8e-05
progressive supranuclear palsy -1.800 6.4e-03
psoriasis -1.100 7.4e-04
Rheumatoid arthritis 2.000 5.2e-03

Gene RIF (14)

AA Sequence

MASGPHSTATAAAAASSAAPSAGGSSSGTTTTTTTTTGGILIGDRLYSEVSLTIDHSLIPEERLSPTPSM      1 - 70
QDGLDLPSETDLRILGCELIQAAGILLRLPQVAMATGQVLFHRFFYSKSFVKHSFEIVAMACINLASKIE     71 - 140
EAPRRIRDVINVFHHLRQLRGKRTPSPLILDQNYINTKNQVIKAERRVLKELGFCVHVKHPHKIIVMYLQ    141 - 210
VLECERNQTLVQTAWNYMNDSLRTNVFVRFQPETIACACIYLAARALQIPLPTRPHWFLLFGTTEEEIQE    211 - 280
ICIETLRLYTRKKPNYELLEKEVEKRKVALQEAKLKAKGLNPDGTPALSTLGGFSPASKPSSPREVKAEE    281 - 350
KSPISINVKTVKKEPEDRQQASKSPYNGVRKDSKRSRNSRSASRSRSRTRSRSRSHTPRRHYNNRRSRSG    351 - 420
TYSSRSRSRSRSHSESPRRHHNHGSPHLKAKHTRDDLKSSNRHGHKRKKSRSRSQSKSRDHSDAAKKHRH    421 - 490
ERGHHRDRRERSRSFERSHKSKHHGGSRSGHGRHRR                                      491 - 526
//

Text Mined References (40)

PMID Year Title