Property Summary

NCBI Gene PubMed Count 40
Grant Count 32
R01 Count 21
Funding $6,446,828.01
PubMed Score 67.99
PubTator Score 52.27

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... -2.798 0.038
diabetes mellitus 1.100 0.002
ovarian cancer -1.300 0.000

Gene RIF (28)

PMID Text
26982741 rs2232710 SNV showed no association with DVT in two Dutch replication cohorts the LETS study and the MEGA study, indicating that the rs2232710 variant is not a risk factor for DVT
25713144 Results show the energetic basis of the Z-dependent protease inhibitor (ZPI)-protein Z (PZ) interaction and suggest an important role for ZPI Lys-239 in PZ catalytic action.
24960590 Protein Z EGF2 subdomain constitutes an interactive-site for ZPI protein.
24315319 The unbalance between PZ and ZPI in plasma samples from patients with Colorectal Cancer or Pancreatic Cancer is not only related to an inflammatory state but could also results from an ectopic synthesis of these proteins by the cancer cells.
24158387 Protein Z/protein Z-dependent protease inhibitor and Fxa expression in human gastric cancer cells indicate that these proteins may play a role in anticoagulant events at the tumor tissue.
23530052 structural features within residues of the 39-loop contribute to the resistance of FIXa to inhibition by plasma inhibitors ZPI and TFPI.
23269381 the PZ/ZPI complex may play some modulating role in hemophilia A
22786881 The study shows by Ala-scanning mutagenesis of the ZPI-binding interface, together with native PAGE and kinetic analyses of PZ binding to ZPI, that Tyr240 and Asp293 of ZPI are crucial hot spots for PZ binding.
22540147 heparin-binding site of ZPI was mapped: basic residues of both helices C and D of ZPI interact with heparin to modulate the inhibitory function of the serpin.
22424030 localization of PZ/ZPI and FX in colon cancer cells indicates that PZ/ZPI may contribute to anticoagulant events at the tumor site.
More...

AA Sequence

MKVVPSLLLSVLLAQVWLVPGLAPSPQSPETPAPQNQTSRVVQAPKEEEEDEQEASEEKASEEEKAWLMA      1 - 70
SRQQLAKETSNFGFSLLRKISMRHDGNMVFSPFGMSLAMTGLMLGATGPTETQIKRGLHLQALKPTKPGL     71 - 140
LPSLFKGLRETLSRNLELGLTQGSFAFIHKDFDVKETFFNLSKRYFDTECVPMNFRNASQAKRLMNHYIN    141 - 210
KETRGKIPKLFDEINPETKLILVDYILFKGKWLTPFDPVFTEVDTFHLDKYKTIKVPMMYGAGKFASTFD    211 - 280
KNFRCHVLKLPYQGNATMLVVLMEKMGDHLALEDYLTTDLVETWLRNMKTRNMEVFFPKFKLDQKYEMHE    281 - 350
LLRQMGIRRIFSPFADLSELSATGRNLQVSRVLQRTVIEVDERGTEAVAGILSEITAYSMPPVIKVDRPF    351 - 420
HFMIYEETSGMLLFLGRVVNPTLL                                                  421 - 444
//

Publication (44)

PMID Year Title
26982741 2016 Single Nucleotide Variant rs2232710 in the Protein Z-Dependent Protease Inhibitor (ZPI, SERPINA10) Gene Is Not Associated with Deep Vein Thrombosis.
26091039 2015 A Single Kinase Generates the Majority of the Secreted Phosphoproteome.
25713144 2015 Thermodynamic and kinetic characterization of the protein Z-dependent protease inhibitor (ZPI)-protein Z interaction reveals an unexpected role for ZPI Lys-239.
24960590 2014 Characterization of the protein Z-dependent protease inhibitor interactive-sites of protein Z.
24315319 2014 Unbalance between plasma levels of Protein Z and protein Z-dependent inhibitor in patients with colorectal and pancreatic cancer: a pilot study.
24172014 2013 Update of the human and mouse SERPIN gene superfamily.
24158387 2014 Protein Z/protein Z-dependent protease inhibitor system in loco in human gastric cancer.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23530052 2013 Residues of the 39-loop restrict the plasma inhibitor specificity of factor IXa.
23375655 2013 Identification of mutations in SLC24A4, encoding a potassium-dependent sodium/calcium exchanger, as a cause of amelogenesis imperfecta.
More...