Property Summary

NCBI Gene PubMed Count 41
PubMed Score 72.91
PubTator Score 52.27

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (3)

Disease log2 FC p
diabetes mellitus 1.100 1.7e-03
ovarian cancer -1.300 5.0e-06
pancreatic ductal adenocarcinoma liver m... -2.798 3.8e-02

Protein-protein Interaction (3)

Gene RIF (29)

AA Sequence

MKVVPSLLLSVLLAQVWLVPGLAPSPQSPETPAPQNQTSRVVQAPKEEEEDEQEASEEKASEEEKAWLMA      1 - 70
SRQQLAKETSNFGFSLLRKISMRHDGNMVFSPFGMSLAMTGLMLGATGPTETQIKRGLHLQALKPTKPGL     71 - 140
LPSLFKGLRETLSRNLELGLTQGSFAFIHKDFDVKETFFNLSKRYFDTECVPMNFRNASQAKRLMNHYIN    141 - 210
KETRGKIPKLFDEINPETKLILVDYILFKGKWLTPFDPVFTEVDTFHLDKYKTIKVPMMYGAGKFASTFD    211 - 280
KNFRCHVLKLPYQGNATMLVVLMEKMGDHLALEDYLTTDLVETWLRNMKTRNMEVFFPKFKLDQKYEMHE    281 - 350
LLRQMGIRRIFSPFADLSELSATGRNLQVSRVLQRTVIEVDERGTEAVAGILSEITAYSMPPVIKVDRPF    351 - 420
HFMIYEETSGMLLFLGRVVNPTLL                                                  421 - 444
//

Text Mined References (45)

PMID Year Title