Property Summary

NCBI Gene PubMed Count 84
Grant Count 54
R01 Count 34
Funding $5,005,749.51
PubMed Score 129.40
PubTator Score 240.27

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
malignant mesothelioma 1.900 0.000
astrocytic glioma -1.200 0.038
osteosarcoma -1.740 0.000
glioblastoma -1.100 0.005
sonic hedgehog group medulloblastoma 1.400 0.000

Synonym

Accession Q9UK53 O00532 O43658 Q53ZR3 Q5T9G8 Q5T9G9 Q5T9H0 Q5T9H1 Q9H007 Q9HD98 Q9HD99 Q9NS83 Q9P0U6 Q9UBC6 Q9UIJ1 Q9UIJ2 Q9UIJ3 Q9UIJ4 Q9UK52
Symbols p33
p47
p33ING1
p24ING1c
p33ING1b
p47ING1a

Gene

PDB

2QIC  

Gene RIF (61)

PMID Text
26439691 ING1a acts as a novel link in the activation of the Rb pathway that can impose senescence in the absence of activating p53-mediated DNA damage signaling, and should prove useful in defining the molecular events contributing to Rb-induced senescence.
26306560 These data indicate that stromal ING1 expression can predict the survival of patients with luminal breast cancer
25613480 Overexpression of let-7b in gastric cancer can inhibit invasion and migration of gastric cancer cells through directly targeting the tumor metastasis-associated gene ING1.
25611387 ING1b finely regulates the hypoxic response by triggering HIF1alpha proteasomal degradation.
25411783 Results show that ING1 expression is under-regulated in pancreatic duct adenocarcinoma (PDAC) and is a direct target of miR-371-5p involved in miR-371-5p inducing promotion of PDAC cells proliferation.
24912621 Our results identify a novel functional relationship between cytoplasmic p33ING1b and oral squamous cell carcinoma patient survival
24903338 ING1b sumoylation regulates the binding of ING1b to the ISG15 and DGCR8 promoters, consequently regulating ISG15 and DGCR8 transcription.
24242916 Ing1b lacking cells showed decreased ability to repair the oxidized DNA.
24008732 ING1 translocates to the mitochondria of primary fibroblasts and established epithelial cell lines in response to apoptosis inducing stimuli, independent of the cellular p53 status.
23585863 Src may play a major role in regulating ING1 levels during tumorigenesis in those cancers in which high levels of Src expression or activity are present.
More...

AA Sequence

MSFVECPYHSPAERLVAEADEGGPSAITGMGLCFRCLLFSFSGRSGVEGGRVDLNVFGSLGLQPWIGSSR      1 - 70
CWGGPCSSALRCGWFSSWPPPSKSAIPIGGGSRGAGRVSRWPPPHWLEAWRVSPLPLSPLSPATFGRGFI     71 - 140
AVAVIPGLWARGRGCSSDRLPRPAGPARRQFQAASLLTRGWGRAWPWKQILKELDECYERFSRETDGAQK    141 - 210
RRMLHCVQRALIRSQELGDEKIQIVSQMVELVENRTRQVDSHVELFEAQQELGDTAGNSGKAGADRPKGE    211 - 280
AAAQADKPNSKRSRRQRNNENRENASSNHDHDDGASGTPKEKKAKTSKKKKRSKAKAEREASPADLPIDP    281 - 350
NEPTYCLCNQVSYGEMIGCDNDECPIEWFHFSCVGLNHKPKGKWYCPKCRGENEKTMDKALEKSKKERAY    351 - 420
NR                                                                        421 - 422
//

Text Mined References (88)

PMID Year Title
26439691 2015 Aging with ING: a comparative study of different forms of stress induced premature senescence.
26306560 2015 Stromal ING1 expression induces a secretory phenotype and correlates with breast cancer patient survival.
25613480 2015 MicroRNA let-7b suppresses human gastric cancer malignancy by targeting ING1.
25611387 2015 ING1b negatively regulates HIF1? protein levels in adipose-derived stromal cells by a SUMOylation-dependent mechanism.
25411783 2014 MiR-371-5p facilitates pancreatic cancer cell proliferation and decreases patient survival.
24912621 2014 Tumor cell apoptosis mediated by cytoplasmic ING1 is associated with improved survival in oral squamous cell carcinoma patients.
24903338 2014 SUMOylation of the ING1b tumor suppressor regulates gene transcription.
24242916 2014 Tumor suppressor Ing1b facilitates DNA repair and prevents oxidative stress induced cell death.
24008732 2013 ING1 induces apoptosis through direct effects at the mitochondria.
23585863 2013 Src regulates the activity of the ING1 tumor suppressor.
More...