Property Summary

NCBI Gene PubMed Count 87
PubMed Score 130.83
PubTator Score 240.27

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
astrocytic glioma -1.200 3.8e-02
glioblastoma -1.100 4.7e-03
malignant mesothelioma 1.900 3.0e-07
osteosarcoma -1.740 8.6e-05
sonic hedgehog group medulloblastoma 1.400 4.9e-06

 GWAS Trait (1)

Gene RIF (64)

AA Sequence

MSFVECPYHSPAERLVAEADEGGPSAITGMGLCFRCLLFSFSGRSGVEGGRVDLNVFGSLGLQPWIGSSR      1 - 70
CWGGPCSSALRCGWFSSWPPPSKSAIPIGGGSRGAGRVSRWPPPHWLEAWRVSPLPLSPLSPATFGRGFI     71 - 140
AVAVIPGLWARGRGCSSDRLPRPAGPARRQFQAASLLTRGWGRAWPWKQILKELDECYERFSRETDGAQK    141 - 210
RRMLHCVQRALIRSQELGDEKIQIVSQMVELVENRTRQVDSHVELFEAQQELGDTAGNSGKAGADRPKGE    211 - 280
AAAQADKPNSKRSRRQRNNENRENASSNHDHDDGASGTPKEKKAKTSKKKKRSKAKAEREASPADLPIDP    281 - 350
NEPTYCLCNQVSYGEMIGCDNDECPIEWFHFSCVGLNHKPKGKWYCPKCRGENEKTMDKALEKSKKERAY    351 - 420
NR                                                                        421 - 422
//

Text Mined References (92)

PMID Year Title