Property Summary

NCBI Gene PubMed Count 16
Grant Count 2
Funding $1,097,752
PubMed Score 6.58
PubTator Score 2.78

Knowledge Summary


No data available


  Differential Expression (10)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.519 0.007
Multiple myeloma 1.914 0.003
psoriasis 1.400 0.000
glioblastoma multiforme 1.200 0.000
oligodendroglioma 1.100 0.000
group 3 medulloblastoma 1.700 0.003
acute quadriplegic myopathy 1.051 0.001
lung cancer 2.000 0.000
diabetes mellitus -1.200 0.003
ovarian cancer 2.300 0.000


Accession Q9UK45
Symbols YNL147W


 Grant Application (2)



 GO Function (1)

Gene RIF (1)

12515382 LSm1-7 proteins colocalize with DCP1,DCP2 and Xrn1 in cytoplasmic foci

AA Sequence

LGLVVCRGTSVVLICPQDGMEAIPNPFIQQQDA                                          71 - 103

Publication (19)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22365833 2012 Dynamic protein-protein interaction wiring of the human spliceosome.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21269460 2011 Initial characterization of the human central proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231747 2004 A protein interaction framework for human mRNA degradation.
15057824 2004 The DNA sequence and biology of human chromosome 19.
14667819 2004 Analysis of a high-throughput yeast two-hybrid system and its use to predict the function of intracellular proteins encoded within the human MHC class III region.