Property Summary

NCBI Gene PubMed Count 17
PubMed Score 6.58
PubTator Score 2.78

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (10)

Disease log2 FC p
acute quadriplegic myopathy 1.051 8.1e-04
diabetes mellitus -1.200 2.8e-03
glioblastoma 1.200 1.1e-02
group 3 medulloblastoma 1.700 2.9e-03
lung cancer 2.000 2.6e-05
Multiple myeloma 1.914 3.1e-03
oligodendroglioma 1.100 2.9e-13
ovarian cancer 2.300 7.5e-07
psoriasis 1.400 1.3e-04
Waldenstrons macroglobulinemia 1.519 7.1e-03

 GO Function (1)

Gene RIF (1)

AA Sequence

MADKEKKKKESILDLSKYIDKTIRVKFQGGREASGILKGFDPLLNLVLDGTIEYMRDPDDQYKLTEDTRQ      1 - 70
LGLVVCRGTSVVLICPQDGMEAIPNPFIQQQDA                                          71 - 103
//

Text Mined References (20)

PMID Year Title