Property Summary

NCBI Gene PubMed Count 41
Grant Count 13
R01 Count 7
Funding $2,578,591.18
PubMed Score 15.21
PubTator Score 15.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (4)

Expression

  Differential Expression (4)

Disease log2 FC p
Multiple myeloma 1.196 0.001
osteosarcoma -1.715 0.000
diabetes mellitus -1.200 0.001
ovarian cancer 2.600 0.000

Gene RIF (15)

PMID Text
25170077 USP8, and the endosomal sorting protein, VPS28, are the negative regulators of NOD2-induced IL-8 secretion.
25098452 CIIA attenuates neurotoxicity caused by OGD/R through inhibiting ASK1-dependent signaling events.
24522193 CIIA functions as a negative modulator of the SOS1-Ras signaling events initiated by peptide growth factors including EGF.
23895345 ESCRT-I complexes contain three common subunits (TSG101, VPS28, and VPS37), and a fourth subunit MVB12. Recombinant ESCRT-I complexes bind HIV-1 p6
23305486 ESCRT-I complexes contain three common subunits (TSG101, VPS28, and VPS37), and a fourth subunit MVB12. Recombinant ESCRT-I complexes bind HIV-1 p6
23027949 ESCRT-I complexes contain three common subunits (TSG101, VPS28, and VPS37), and a fourth subunit MVB12. Recombinant ESCRT-I complexes bind HIV-1 p6
22004035 ESCRT-I complexes contain three common subunits (TSG101, VPS28, and VPS37), and a fourth subunit MVB12. Recombinant ESCRT-I complexes bind HIV-1 p6
21762798 ESCRT-I complexes contain three common subunits (TSG101, VPS28, and VPS37), and a fourth subunit MVB12. Recombinant ESCRT-I complexes bind HIV-1 p6
20708039 Data show that gamma2-adaptin in MVB sorting specifically interacts with the ESCRT subunits Vps28 and CHMP2A.
19524996 Overall, we see no role for the ESCRT pathway in influenza virus budding and the significance of the M1-VPS28 interaction remains to be determined.
More...

AA Sequence

MFHGIPATPGIGAPGNKPELYEEVKLYKNAREREKYDNMAELFAVVKTMQALEKAYIKDCVSPSEYTAAC      1 - 70
SRLLVQYKAAFRQVQGSEISSIDEFCRKFRLDCPLAMERIKEDRPITIKDDKGNLNRCIADVVSLFITVM     71 - 140
DKLRLEIRAMDEIQPDLRELMETMHRMSHLPPDFEGRQTVSQWLQTLSGMSASDELDDSQVRQMLFDLES    141 - 210
AYNAFNRFLHA                                                               211 - 221
//

Publication (44)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
25201988 2014 Common genetic variants associated with cognitive performance identified using the proxy-phenotype method.
25170077 2014 A genome-wide small interfering RNA (siRNA) screen reveals nuclear factor-?B (NF-?B)-independent regulators of NOD2-induced interleukin-8 (IL-8) secretion.
25098452 2014 CIIA negatively regulates neuronal cell death induced by oxygen-glucose deprivation and reoxygenation.
24522193 2014 CIIA negatively regulates the Ras-Erk1/2 signaling pathway through inhibiting the Ras-specific GEF activity of SOS1.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22232651 2012 Structural basis for membrane targeting by the MVB12-associated ?-prism domain of the human ESCRT-I MVB12 subunit.
More...