Property Summary

NCBI Gene PubMed Count 42
PubMed Score 15.54
PubTator Score 15.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8520 2.9e-07
osteosarcoma 7950 1.3e-06
Multiple myeloma 1332 1.1e-03
diabetes mellitus 1728 1.2e-03

Expression

  Differential Expression (4)

Disease log2 FC p
diabetes mellitus -1.200 1.2e-03
Multiple myeloma 1.196 1.1e-03
osteosarcoma -1.715 1.3e-06
ovarian cancer 2.600 2.9e-07

Gene RIF (15)

AA Sequence

MFHGIPATPGIGAPGNKPELYEEVKLYKNAREREKYDNMAELFAVVKTMQALEKAYIKDCVSPSEYTAAC      1 - 70
SRLLVQYKAAFRQVQGSEISSIDEFCRKFRLDCPLAMERIKEDRPITIKDDKGNLNRCIADVVSLFITVM     71 - 140
DKLRLEIRAMDEIQPDLRELMETMHRMSHLPPDFEGRQTVSQWLQTLSGMSASDELDDSQVRQMLFDLES    141 - 210
AYNAFNRFLHA                                                               211 - 221
//

Text Mined References (45)

PMID Year Title