Property Summary

NCBI Gene PubMed Count 11
PubMed Score 34.33
PubTator Score 118.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
astrocytic glioma -1.600 0.025
ependymoma -1.700 0.041
oligodendroglioma -1.500 0.032
osteosarcoma -4.304 0.000
lung cancer -1.100 0.009
ovarian cancer 1.200 0.000
psoriasis 1.700 0.000

Synonym

Accession Q9UK39 D3DNY5 Q14D51 Q9HD93 Q9HD94 Q9HD95
Symbols NOC
CCR4L
Ccr4c
CCRN4L

Gene

Gene RIF (8)

PMID Text
26541675 results highlight the clinical significance of PARN and NOC on the survival in SCC diagnosed patients.
24821610 Three tag SNPs (rs938836, rs17050680, rs3805213) in the CCRN4L are significant correlation with genotype and allele frequency in lung cancer.
23922759 Genetic variation in the NOC gene is associated with body mass index in Chinese subjects.
22547059 Ccr4d functions as an anti-proliferating protein through the induction of cell cycle arrest via a p21-dependent and p53-independent pathway and suggest that Ccr4d might have an important role in carcinogenesis.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
18587630 The transcription of human nocturnin gene displayed circadian oscillations in Huh7 cells (a human hepatoma cell line) and was regulated by CLOCK/BMAL1 heterodimer via the E-box of nocturnin promoter.
16821125 A human lung cancer cell line SBC-5 that efficiently metastasized to bone when intravenously injected into SCID mice was found to express CCR4.

AA Sequence

MFHSPRRLCSALLQRDAPGLRRLPAPGLRRPLSPPAAVPRPASPRLLAAASAASGAARSCSRTVCSMGTG      1 - 70
TSRLYSALAKTLNSSAASQHPEYLVSPDPEHLEPIDPKELLEECRAVLHTRPPRFQRDFVDLRTDCPSTH     71 - 140
PPIRVMQWNILAQALGEGKDNFVQCPVEALKWEERKCLILEEILAYQPDILCLQEVDHYFDTFQPLLSRL    141 - 210
GYQGTFFPKPWSPCLDVEHNNGPDGCALFFLQNRFKLVNSANIRLTAMTLKTNQVAIAQTLECKESGRQF    211 - 280
CIAVTHLKARTGWERFRSAQGCDLLQNLQNITQGAKIPLIVCGDFNAEPTEEVYKHFASSSLNLNSAYKL    281 - 350
LSADGQSEPPYTTWKIRTSGECRHTLDYIWYSKHALNVRSALDLLTEEQIGPNRLPSFNYPSDHLSLVCD    351 - 420
FSFTEESDGLS                                                               421 - 431
//

Publication (14)

PMID Year Title
26541675 2015 Poly(A)-specific ribonuclease and Nocturnin in squamous cell lung cancer: prognostic value and impact on gene expression.
24821610 2014 Association between CLOCK, PER3 and CCRN4L with non?small cell lung cancer in Brazilian patients.
23922759 2013 Genetic variation in the NOC gene is associated with body mass index in Chinese subjects.
22608110 2012 Nocturnin: at the crossroads of clocks and metabolism.
22547059 2012 RNA processing and modification protein, carbon catabolite repression 4 (Ccr4), arrests the cell cycle through p21-dependent and p53-independent pathway.
22331129 2012 The role of nocturnin in early adipogenesis and modulation of systemic insulin resistance in human.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
18587630 2008 CLOCK/BMAL1 regulates human nocturnin transcription through binding to the E-box of nocturnin promoter.
16821125 2006 RANKL-induced CCL22/macrophage-derived chemokine produced from osteoclasts potentially promotes the bone metastasis of lung cancer expressing its receptor CCR4.
More...