Property Summary

NCBI Gene PubMed Count 11
PubMed Score 8.84
PubTator Score 8.59

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
ovarian cancer 8492 2.58618086499511E-10
psoriasis 6685 1.6328649637566E-7
osteosarcoma 7933 2.73669872059391E-4
Gaucher disease type 1 171 0.0252037152963402
Disease Target Count Z-score Confidence
Acute monocytic leukemia 11 3.7 1.9

Expression

  Differential Expression (4)

Disease log2 FC p
psoriasis -1.200 0.000
osteosarcoma -1.700 0.000
ovarian cancer 1.700 0.000
Gaucher disease type 1 1.200 0.025

Synonym

Accession Q9UK33 B2RC05 Q9NPP7
Symbols

Gene

  Ortholog (6)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG
Opossum OMA EggNOG Inparanoid

Gene RIF (5)

PMID Text
24771066 These results suggest that ZNF580 mediates eNOS expression and endothelial cell migration/proliferation via the TGF-b1/ALK5/Smad2 pathway, and thus plays a crucial role in vascular endothelial cells.
21830064 H2O2 upregulates the expression of ZNF580 via the NF-kappaB signaling pathway, and overexpression of ZNF580 plays a critical role in augmenting the release of pro-inflammatory cytokine IL-8.
21599657 ZNF580 is a binding partner of Smad2 and is involved in the signal transduction of the transforming growth factor-beta signalling pathway.
21310414 ZNF580 is a novel factor in the lipoprotein-dependent regulation of endothelial IL-8 expression and monocyte arrest.
20382120 These results elucidate the important role that ZNF580 plays in the process of migration and proliferation of endothelial cells, which provides a foundation for a novel approach to regulate angiogenesis.

AA Sequence

MLLLPPRPPHPRSSSPEAMDPPPPKAPPFPKAEGPSSTPSSAAGPRPPRLGRHLLIDANGVPYTYTVQLE      1 - 70
EEPRGPPQREAPPGEPGPRKGYSCPECARVFASPLRLQSHRVSHSDLKPFTCGACGKAFKRSSHLSRHRA     71 - 140
THRARAGPPHTCPLCPRRFQDAAELAQHVRLH                                          141 - 172
//

Text Mined References (14)

PMID Year Title
24771066 2014 ZNF580 mediates eNOS expression and endothelial cell migration/proliferation via the TGF-?1/ALK5/Smad2 pathway.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21830064 2012 ROS-induced ZNF580 expression: a key role for H2O2/NF-?B signaling pathway in vascular endothelial inflammation.
21599657 2011 ZNF580, a novel C2H2 zinc-finger transcription factor, interacts with the TGF-? signal molecule Smad2.
21310414 2011 Suppression of zinc finger protein 580 by high oxLDL/LDL-ratios is followed by enhanced expression of endothelial IL-8.
20382120 2010 Sphingosine-1-phosphate induces human endothelial VEGF and MMP-2 production via transcription factor ZNF580: novel insights into angiogenesis.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
More...