Property Summary

NCBI Gene PubMed Count 11
PubMed Score 8.84
PubTator Score 8.59

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
psoriasis -1.200 0.000
osteosarcoma -1.700 0.000
ovarian cancer 1.700 0.000
Gaucher disease type 1 1.200 0.025

Gene RIF (5)

PMID Text
24771066 These results suggest that ZNF580 mediates eNOS expression and endothelial cell migration/proliferation via the TGF-b1/ALK5/Smad2 pathway, and thus plays a crucial role in vascular endothelial cells.
21830064 H2O2 upregulates the expression of ZNF580 via the NF-kappaB signaling pathway, and overexpression of ZNF580 plays a critical role in augmenting the release of pro-inflammatory cytokine IL-8.
21599657 ZNF580 is a binding partner of Smad2 and is involved in the signal transduction of the transforming growth factor-beta signalling pathway.
21310414 ZNF580 is a novel factor in the lipoprotein-dependent regulation of endothelial IL-8 expression and monocyte arrest.
20382120 These results elucidate the important role that ZNF580 plays in the process of migration and proliferation of endothelial cells, which provides a foundation for a novel approach to regulate angiogenesis.

AA Sequence

MLLLPPRPPHPRSSSPEAMDPPPPKAPPFPKAEGPSSTPSSAAGPRPPRLGRHLLIDANGVPYTYTVQLE      1 - 70
EEPRGPPQREAPPGEPGPRKGYSCPECARVFASPLRLQSHRVSHSDLKPFTCGACGKAFKRSSHLSRHRA     71 - 140
THRARAGPPHTCPLCPRRFQDAAELAQHVRLH                                          141 - 172
//

Text Mined References (14)

PMID Year Title
24771066 2014 ZNF580 mediates eNOS expression and endothelial cell migration/proliferation via the TGF-?1/ALK5/Smad2 pathway.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21830064 2012 ROS-induced ZNF580 expression: a key role for H2O2/NF-?B signaling pathway in vascular endothelial inflammation.
21599657 2011 ZNF580, a novel C2H2 zinc-finger transcription factor, interacts with the TGF-? signal molecule Smad2.
21310414 2011 Suppression of zinc finger protein 580 by high oxLDL/LDL-ratios is followed by enhanced expression of endothelial IL-8.
20382120 2010 Sphingosine-1-phosphate induces human endothelial VEGF and MMP-2 production via transcription factor ZNF580: novel insights into angiogenesis.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
More...