Property Summary

NCBI Gene PubMed Count 11
PubMed Score 11.43
PubTator Score 8.59

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 2.6e-10
psoriasis 6694 1.6e-07
osteosarcoma 7950 2.7e-04
Gaucher disease type 1 180 2.5e-02
Disease Target Count Z-score Confidence
Acute monocytic leukemia 13 3.483 1.7

Expression

  Differential Expression (4)

Disease log2 FC p
Gaucher disease type 1 1.200 2.5e-02
osteosarcoma -1.700 2.7e-04
ovarian cancer 1.700 2.6e-10
psoriasis -1.200 1.6e-07

Gene RIF (5)

AA Sequence

MLLLPPRPPHPRSSSPEAMDPPPPKAPPFPKAEGPSSTPSSAAGPRPPRLGRHLLIDANGVPYTYTVQLE      1 - 70
EEPRGPPQREAPPGEPGPRKGYSCPECARVFASPLRLQSHRVSHSDLKPFTCGACGKAFKRSSHLSRHRA     71 - 140
THRARAGPPHTCPLCPRRFQDAAELAQHVRLH                                          141 - 172
//

Text Mined References (15)

PMID Year Title