Property Summary

Ligand Count 4
NCBI Gene PubMed Count 26
PubMed Score 21.55
PubTator Score 26.32

Knowledge Summary

Patent (6,775)

Expression

  Differential Expression (17)

Disease log2 FC p
active Crohn's disease -1.314 3.3e-02
active ulcerative colitis -1.621 4.6e-03
adult high grade glioma -2.100 2.0e-04
Astrocytoma, Pilocytic -1.500 5.8e-06
atypical teratoid / rhabdoid tumor -1.500 3.2e-03
colon cancer -2.300 7.1e-04
cystic fibrosis 1.571 4.2e-05
ependymoma -1.400 1.1e-06
glioblastoma -1.800 8.6e-08
group 4 medulloblastoma -1.600 6.0e-04
interstitial cystitis -1.100 8.0e-04
intraductal papillary-mucinous adenoma (... 1.100 4.2e-02
lung cancer 2.500 1.3e-04
lung carcinoma 2.500 1.7e-26
malignant mesothelioma -4.200 2.1e-08
medulloblastoma, large-cell -2.000 1.5e-03
ovarian cancer -1.100 4.1e-03

Gene RIF (18)

AA Sequence

MLPFAPQDEPWDREMEVFSGGGASSGEVNGLKMVDEPMEEGEADSCHDEGVVKEIPITHHVKEGYEKADP      1 - 70
AQFELLKVLGQGSFGKVFLVRKKTGPDAGQLYAMKVLKKASLKVRDRVRTKMERDILVEVNHPFIVKLHY     71 - 140
AFQTEGKLYLILDFLRGGDVFTRLSKEVLFTEEDVKFYLAELALALDHLHQLGIVYRDLKPENILLDEIG    141 - 210
HIKLTDFGLSKESVDQEKKAYSFCGTVEYMAPEVVNRRGHSQSADWWSYGVLMFEMLTGTLPFQGKDRNE    211 - 280
TMNMILKAKLGMPQFLSAEAQSLLRMLFKRNPANRLGSEGVEEIKRHLFFANIDWDKLYKREVQPPFKPA    281 - 350
SGKPDDTFCFDPEFTAKTPKDSPGLPASANAHQLFKGFSFVATSIAEEYKITPITSANVLPIVQINGNAA    351 - 420
QFGEVYELKEDIGVGSYSVCKRCIHATTNMEFAVKIIDKSKRDPSEEIEILMRYGQHPNIITLKDVFDDG    421 - 490
RYVYLVTDLMKGGELLDRILKQKCFSEREASDILYVISKTVDYLHCQGVVHRDLKPSNILYMDESASADS    491 - 560
IRICDFGFAKQLRGENGLLLTPCYTANFVAPEVLMQQGYDAACDIWSLGVLFYTMLAGYTPFANGPNDTP    561 - 630
EEILLRIGNGKFSLSGGNWDNISDGAKDLLSHMLHMDPHQRYTAEQILKHSWITHRDQLPNDQPKRNDVS    631 - 700
HVVKGAMVATYSALTHKTFQPVLEPVAASSLAQRRSMKKRTSTGL                             701 - 745
//

Text Mined References (30)

PMID Year Title