Property Summary

NCBI Gene PubMed Count 26
Grant Count 6
R01 Count 6
Funding $224,907.16
PubMed Score 21.17
PubTator Score 26.32

Knowledge Summary

Patent (6,775)

Expression

  Differential Expression (17)

Disease log2 FC p
malignant mesothelioma -4.200 0.000
ependymoma -1.400 0.000
glioblastoma -2.300 0.000
cystic fibrosis 1.571 0.000
atypical teratoid / rhabdoid tumor -1.500 0.003
group 4 medulloblastoma -1.600 0.001
medulloblastoma, large-cell -2.000 0.001
intraductal papillary-mucinous adenoma (... 1.100 0.042
colon cancer -2.300 0.001
lung cancer 2.500 0.000
active Crohn's disease -1.314 0.033
active ulcerative colitis -1.621 0.005
interstitial cystitis -1.800 0.000
adult high grade glioma -2.100 0.000
pilocytic astrocytoma -1.600 0.000
lung carcinoma 2.500 0.000
ovarian cancer -1.100 0.004

Synonym

Accession Q9UK32 B2R854 B7ZL90 Q6FHX2 Q8WX28 Q9H4S6 S6K-alpha-6
Symbols RSK4
RSK-4
p90RSK6
PP90RSK4
S6K-alpha-6

Gene

  TechDev Info (1)

Gary Johnson 233 Kinome profile via MIB/MS Technology

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (18)

PMID Text
26732474 RSK4 is expressed at low levels in malignant ovarian tumors, which correlates with advanced stages of the disease.
26397146 downregulation of RSK4 expression is indicated to be associated with tumor cell proliferation and invasion, and silencing of the RSK4 may be involved in the development and progression of breast cancer
25197367 Low RSK4 expression is correlated with advanced clinical pathologic classifications and is a poor overall survival in colorectal cancer patients
24338215 RSK4 mRNA is significantly decreased in most of breast cancer tissues compared with paired non-cancerous tissues, due to promoter hypermethylation; frequent epigenetic inactivation might have a role in precancerous lesions or early cancer
23942078 evaluated expression of RSK4 in renal cell carcinoma(RCC)tissues, analysed relationship between RSK4 expression and clinicopathological features of RCC patients and explored potential molecular mechanisms of RSK4 in RCC cell lines; expression pattern and molecular mechanisms of RSK4 in RCCs indicate it could be a potential independent prognostic factor
23635776 Overexpression of RSK3 or RSK4 supports tumor cell proliferation upon PI3K inhibition both in vitro and in vivo therby contributing to drug resistance.
22297070 Suggest that RSK4 may serve as a mediator of endothelial progenitor cell senescence in diabetes mellitus.
22020623 findings reveals a major role of PRKX, TTBK2 and RSK4 in triggering Sunitinib resistance formation; data suggest transcriptional regulation of these kinases together with other proteins might play an important role in formation of Sunitinib resistance by affecting transcription factors
21875487 The expression level of RSK-4 mRNA in breast cancer was significantly lower than those in normal breast tissues and breast benign lesions tissues. The down-regulation of RSK-4 expression in breast caner suggests that it is a breast cancer suppressor gene.
21384559 A total of six novel and 11 known single nucleotide polymorphisms were identified. Further studies are warranted to analyze the candidate genes at Xq11.1-q21.33.
More...

AA Sequence

MLPFAPQDEPWDREMEVFSGGGASSGEVNGLKMVDEPMEEGEADSCHDEGVVKEIPITHHVKEGYEKADP      1 - 70
AQFELLKVLGQGSFGKVFLVRKKTGPDAGQLYAMKVLKKASLKVRDRVRTKMERDILVEVNHPFIVKLHY     71 - 140
AFQTEGKLYLILDFLRGGDVFTRLSKEVLFTEEDVKFYLAELALALDHLHQLGIVYRDLKPENILLDEIG    141 - 210
HIKLTDFGLSKESVDQEKKAYSFCGTVEYMAPEVVNRRGHSQSADWWSYGVLMFEMLTGTLPFQGKDRNE    211 - 280
TMNMILKAKLGMPQFLSAEAQSLLRMLFKRNPANRLGSEGVEEIKRHLFFANIDWDKLYKREVQPPFKPA    281 - 350
SGKPDDTFCFDPEFTAKTPKDSPGLPASANAHQLFKGFSFVATSIAEEYKITPITSANVLPIVQINGNAA    351 - 420
QFGEVYELKEDIGVGSYSVCKRCIHATTNMEFAVKIIDKSKRDPSEEIEILMRYGQHPNIITLKDVFDDG    421 - 490
RYVYLVTDLMKGGELLDRILKQKCFSEREASDILYVISKTVDYLHCQGVVHRDLKPSNILYMDESASADS    491 - 560
IRICDFGFAKQLRGENGLLLTPCYTANFVAPEVLMQQGYDAACDIWSLGVLFYTMLAGYTPFANGPNDTP    561 - 630
EEILLRIGNGKFSLSGGNWDNISDGAKDLLSHMLHMDPHQRYTAEQILKHSWITHRDQLPNDQPKRNDVS    631 - 700
HVVKGAMVATYSALTHKTFQPVLEPVAASSLAQRRSMKKRTSTGL                             701 - 745
//

Publication (30)

PMID Year Title
26732474 2016 Ribosomal S6 kinase 4 (RSK4) expression in ovarian tumors and its regulation by antineoplastic drugs in ovarian cancer cell lines.
26397146 2015 RSK4 knockdown promotes proliferation, migration and metastasis of human breast adenocarcinoma cells.
25197367 2014 Low expression of RSK4 predicts poor prognosis in patients with colorectal cancer.
24338215 2014 Frequent epigenetic inactivation of RSK4 by promoter methylation in cancerous and non-cancerous tissues of breast cancer.
23942078 2013 Ribosomal s6 protein kinase 4: a prognostic factor for renal cell carcinoma.
23635776 2013 RSK3/4 mediate resistance to PI3K pathway inhibitors in breast cancer.
22297070 2012 The possible role of ribosomal protein S6 kinase 4 in the senescence of endothelial progenitor cells in diabetes mellitus.
22020623 2012 PRKX, TTBK2 and RSK4 expression causes Sunitinib resistance in kidney carcinoma- and melanoma-cell lines.
21875487 2011 [Abnormal expression of RSK-4 and its clinical significance in breast cancer].
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
More...