Property Summary

NCBI Gene PubMed Count 20
PubMed Score 107.17
PubTator Score 29.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -1.100 1.7e-02
astrocytic glioma -1.200 1.5e-03
atypical teratoid / rhabdoid tumor -1.300 3.1e-05
ependymoma -1.400 5.2e-03
glioblastoma -1.200 4.7e-03
group 3 medulloblastoma -1.300 3.2e-02
medulloblastoma, large-cell -1.700 3.0e-03
ovarian cancer 1.100 8.9e-05
Pick disease -1.400 2.3e-04
primitive neuroectodermal tumor -1.600 1.4e-03
psoriasis 1.300 1.7e-04

Gene RIF (7)

AA Sequence

MATSTGRWLLLRLALFGFLWEASGGLDSGASRDDDLLLPYPRARARLPRDCTRVRAGNREHESWPPPPAT      1 - 70
PGAGGLAVRTFVSHFRDRAVAGHLTRAVEPLRTFSVLEPGGPGGCAARRRATVEETARAADCRVAQNGGF     71 - 140
FRMNSGECLGNVVSDERRVSSSGGLQNAQFGIRRDGTLVTGYLSEEEVLDTENPFVQLLSGVVWLIRNGS    141 - 210
IYINESQATECDETQETGSFSKFVNVISARTAIGHDRKGQLVLFHADGQTEQRGINLWEMAEFLLKQDVV    211 - 280
NAINLDGGGSATFVLNGTLASYPSDHCQDNMWRCPRQVSTVVCVHEPRCQPPDCHGHGTCVDGHCQCTGH    281 - 350
FWRGPGCDELDCGPSNCSQHGLCTETGCRCDAGWTGSNCSEECPLGWHGPGCQRPCKCEHHCPCDPKTGN    351 - 420
CSVSRVKQCLQPPEATLRAGELSFFTRTAWLALTLALAFLLLISTAANLSLLLSRAERNRRLHGDYAYHP    421 - 490
LQEMNGEPLAAEKEQPGGAHNPFKD                                                 491 - 515
//

Text Mined References (22)

PMID Year Title