Property Summary

NCBI Gene PubMed Count 18
PubMed Score 24.94
PubTator Score 24.23

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
oligodendroglioma 2849 9.98629602294747E-11
sonic hedgehog group medulloblastoma 1482 4.53941878106273E-9
medulloblastoma, large-cell 6234 1.772440744906E-7
atypical teratoid / rhabdoid tumor 4369 3.05739694567212E-7
pediatric high grade glioma 2712 2.15894474397353E-6
Breast cancer 3099 1.19585757664694E-5
primitive neuroectodermal tumor 3031 1.20305653623935E-4
glioblastoma 5572 2.54635645543085E-4
psoriasis 6685 3.18101196495962E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 3.83700601828054E-4
primary pancreatic ductal adenocarcinoma 1271 0.00181544394159565
pancreatic cancer 2300 0.00425752086638813
astrocytic glioma 2241 0.0116746328306199
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0199249279073012
non primary Sjogren syndrome sicca 840 0.0353955770429313
Disease Target Count Z-score Confidence
Benign paroxysmal positional nystagmus 13 4.035 2.0

Expression

Synonym

Accession Q9UK22 B2R7K7 Q5TGY0 Q6FGJ7 Q8TB29 Q9UKC6
Symbols FBG1
FBX2
Fbs1
OCP1
NFB42

Gene

  Ortholog (10)

 IMPC Term (1)

Gene RIF (4)

PMID Text
26460611 Although the overall structure of FBG3 is similar to that of Fbs1, the residues that form the Fbs1 carbohydrate-binding pocket failed to be superposed with the corresponding residues of FBG3.
26295339 FBG1 degrades A1AT-Z through a Beclin1-dependent arm of autophagy.
21135578 FBG1 is unique among known F-box proteins in that it contains a non-canonical D-Box within F-box domain, required for the growth arrest.
12904574 interaction of the HSV-1 UL9 protein with NFB42 results in its polyubiquitination and subsequent degradation by the 26S proteasome

AA Sequence

MDGDGDPESVGQPEEASPEEQPEEASAEEERPEDQQEEEAAAAAAYLDELPEPLLLRVLAALPAAELVQA      1 - 70
CRLVCLRWKELVDGAPLWLLKCQQEGLVPEGGVEEERDHWQQFYFLSKRRRNLLRNPCGEEDLEGWCDVE     71 - 140
HGGDGWRVEELPGDSGVEFTHDESVKKYFASSFEWCRKAQVIDLQAEGYWEELLDTTQPAIVVKDWYSGR    141 - 210
SDAGCLYELTVKLLSEHENVLAEFSSGQVAVPQDSDGGGWMEISHTFTDYGPGVRFVRFEHGGQDSVYWK    211 - 280
GWFGARVTNSSVWVEP                                                          281 - 296
//

Text Mined References (20)

PMID Year Title
26460611 2015 The Structural Differences between a Glycoprotein Specific F-Box Protein Fbs1 and Its Homologous Protein FBG3.
26295339 2015 FBG1 Is the Final Arbitrator of A1AT-Z Degradation.
25416956 2014 A proteome-scale map of the human interactome network.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21378169 2011 A Competitive binding mechanism between Skp1 and exportin 1 (CRM1) controls the localization of a subset of F-box proteins.
21269460 2011 Initial characterization of the human central proteome.
21135578 2010 FBG1 is a promiscuous ubiquitin ligase that sequesters APC2 and causes S-phase arrest.
19028597 2009 Maturation of human dendritic cells is accompanied by functional remodelling of the ubiquitin-proteasome system.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...