Property Summary

NCBI Gene PubMed Count 21
PubMed Score 26.83
PubTator Score 24.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

 IMPC Phenotype (1)

Gene RIF (6)

AA Sequence

MDGDGDPESVGQPEEASPEEQPEEASAEEERPEDQQEEEAAAAAAYLDELPEPLLLRVLAALPAAELVQA      1 - 70
CRLVCLRWKELVDGAPLWLLKCQQEGLVPEGGVEEERDHWQQFYFLSKRRRNLLRNPCGEEDLEGWCDVE     71 - 140
HGGDGWRVEELPGDSGVEFTHDESVKKYFASSFEWCRKAQVIDLQAEGYWEELLDTTQPAIVVKDWYSGR    141 - 210
SDAGCLYELTVKLLSEHENVLAEFSSGQVAVPQDSDGGGWMEISHTFTDYGPGVRFVRFEHGGQDSVYWK    211 - 280
GWFGARVTNSSVWVEP                                                          281 - 296
//

Text Mined References (23)

PMID Year Title