Property Summary

NCBI Gene PubMed Count 60
Grant Count 112
R01 Count 72
Funding $9,428,525.79
PubMed Score 205.16
PubTator Score 208.07

Knowledge Summary

Patent (4,378)

Expression

  Differential Expression (20)

Disease log2 FC p
urothelial carcinoma -2.500 0.003
Parkinson's disease -1.300 0.030
malignant mesothelioma 1.800 0.000
astrocytic glioma -1.200 0.020
posterior fossa group A ependymoma -1.700 0.000
oligodendroglioma -1.500 0.026
glioblastoma -1.800 0.004
atypical teratoid / rhabdoid tumor -2.600 0.000
medulloblastoma, large-cell -3.700 0.000
lung cancer -1.300 0.006
colon cancer -2.100 0.000
active Crohn's disease 4.248 0.000
active ulcerative colitis 3.578 0.000
interstitial cystitis -1.100 0.044
adult high grade glioma -1.400 0.002
aldosterone-producing adenoma 1.975 0.015
lung carcinoma 4.000 0.000
progressive supranuclear palsy 1.400 0.027
ovarian cancer -1.600 0.000
pituitary cancer 1.800 0.000

Synonym

Accession Q9UK17 O60576 O60577 Q14D71 Q5T0M0 Q9UH85 Q9UH86 Q9UK16
Symbols KV4.3
SCA19
SCA22
BRGDA9
KCND3L
KCND3S
KSHIVB

Gene

PDB

1S1G   2NZ0  

Gene RIF (41)

PMID Text
26216464 Mefloquine is a concentration-dependent Ito and hKv4.3 channel blocker.
26016905 mutations cause a gainoffunction of KV4.3/KChIP2encoded channels by increasing membrane protein expression and slowing channel inactivation.
25854634 Altered Kv4.3 channel localization and/or functioning resulting from SCA19/22 mutations may lead to Purkinje cell loss, neurodegeneration and ataxia.
25600224 the interaction of DPP10a, expressed in human atrium, with Kv4.3 channels generates a sustained current component of Ito, which may affect late repolarization phase of atrial action potentials.
24963029 Demonstrate SEMA3A as a naturally occurring protein that selectively inhibits Kv4.3 and SEMA3A as a possible Brugada syndrome susceptibility gene through a Kv4.3 gain-of-function mechanism.
24845726 These results indicate that Kv4.3 is likely the target of discrepin and highlight the importance of the basic residue K13, located in the alpha-helix of the toxin, for current blockage.
24762397 Kv4.3 K(+) channel is involved in heart hypertrophy/heart failure independently of its electric function.[review]
23963749 findings indicate mutations in KCND3 are not a common cause of disease among rarer types of European cerebellar ataxia; however 2 variants were identified in the SCA cases: p.L450F and p.P614S; mutations in KCND3 can cause 2 allelic disorders, SCA19/22 and Brugada syndrome which may co-occur
23400760 Report a KV4.3 gain-of-function mutation in early-onset persistent lone atrial fibrillation.
23291429 The biophysical characteristics of Kv4.3 channels are strongly dependent on temperature.
More...

AA Sequence

MAAGVAAWLPFARAAAIGWMPVANCPMPLAPADKNKRQDELIVLNVSGRRFQTWRTTLERYPDTLLGSTE      1 - 70
KEFFFNEDTKEYFFDRDPEVFRCVLNFYRTGKLHYPRYECISAYDDELAFYGILPEIIGDCCYEEYKDRK     71 - 140
RENAERLMDDNDSENNQESMPSLSFRQTMWRAFENPHTSTLALVFYYVTGFFIAVSVITNVVETVPCGTV    141 - 210
PGSKELPCGERYSVAFFCLDTACVMIFTVEYLLRLFAAPSRYRFIRSVMSIIDVVAIMPYYIGLVMTNNE    211 - 280
DVSGAFVTLRVFRVFRIFKFSRHSQGLRILGYTLKSCASELGFLLFSLTMAIIIFATVMFYAEKGSSASK    281 - 350
FTSIPASFWYTIVTMTTLGYGDMVPKTIAGKIFGSICSLSGVLVIALPVPVIVSNFSRIYHQNQRADKRR    351 - 420
AQKKARLARIRVAKTGSSNAYLHSKRNGLLNEALELTGTPEEEHMGKTTSLIESQHHHLLHCLEKTTGLS    421 - 490
YLVDDPLLSVRTSTIKNHEFIDEQMFEQNCMESSMQNYPSTRSPSLSSHPGLTTTCCSRRSKKTTHLPNS    491 - 560
NLPATRLRSMQELSTIHIQGSEQPSLTTSRSSLNLKADDGLRPNCKTSQITTAIISIPTPPALTPEGESR    561 - 630
PPPASPGPNTNIPSIASNVVKVSAL                                                 631 - 655
//

Text Mined References (60)

PMID Year Title
26216464 2015 Modulation of the transient outward current (Ito) in rat cardiac myocytes and human Kv4.3 channels by mefloquine.
26016905 2015 Two novel Brugada syndrome-associated mutations increase KV4.3 membrane expression and function.
25854634 2015 Spinocerebellar ataxia type 19/22 mutations alter heterocomplex Kv4.3 channel function and gating in a dominant manner.
25600224 2015 Interaction of DPP10a with Kv4.3 channel complex results in a sustained current component of human transient outward current Ito.
24963029 2014 Characterization of SEMA3A-encoded semaphorin as a naturally occurring Kv4.3 protein inhibitor and its contribution to Brugada syndrome.
24850809 2014 Genetic determinants of P wave duration and PR segment.
24845726 2014 Interaction of the scorpion toxin discrepin with Kv4.3 channels and A-type K(+) channels in cerebellum granular cells.
24785509 2014 A genome wide association study (GWAS) providing evidence of an association between common genetic variants and late radiotherapy toxicity.
24762397 2014 The potential role of Kv4.3 K+ channel in heart hypertrophy.
23963749 2013 The L450F [Corrected] mutation in KCND3 brings spinocerebellar ataxia and Brugada syndrome closer together.
More...