Property Summary

Ligand Count 5
NCBI Gene PubMed Count 60
PubMed Score 217.90
PubTator Score 208.07

Knowledge Summary

Patent (4,378)

TINX Plot

  Disease (9)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.2
Kidney cancer 2613 0.0 0.8
Disease Target Count Z-score Confidence
Heart disease 306 4.798 2.4
Acquired metabolic disease 336 0.0 1.7
Disease Target Count
Brugada syndrome 29

Expression

  Differential Expression (20)

Disease log2 FC p
active Crohn's disease 4.248 7.1e-05
active ulcerative colitis 3.578 3.2e-04
adult high grade glioma -1.400 2.5e-03
aldosterone-producing adenoma 1.763 1.5e-02
astrocytic glioma -1.200 2.0e-02
atypical teratoid / rhabdoid tumor -2.600 4.3e-04
colon cancer -2.100 8.1e-05
ependymoma -1.500 2.6e-02
glioblastoma -1.200 2.0e-03
interstitial cystitis -1.100 4.4e-02
lung cancer -1.300 6.4e-03
lung carcinoma 4.000 6.6e-48
malignant mesothelioma 1.800 1.4e-06
medulloblastoma, large-cell -1.100 2.3e-04
oligodendroglioma -1.500 2.6e-02
ovarian cancer -1.600 4.9e-06
Parkinson's disease -1.300 3.0e-02
pituitary cancer 1.800 2.5e-04
progressive supranuclear palsy 1.400 2.7e-02
urothelial carcinoma -2.500 3.0e-03

Gene RIF (41)

AA Sequence

MAAGVAAWLPFARAAAIGWMPVANCPMPLAPADKNKRQDELIVLNVSGRRFQTWRTTLERYPDTLLGSTE      1 - 70
KEFFFNEDTKEYFFDRDPEVFRCVLNFYRTGKLHYPRYECISAYDDELAFYGILPEIIGDCCYEEYKDRK     71 - 140
RENAERLMDDNDSENNQESMPSLSFRQTMWRAFENPHTSTLALVFYYVTGFFIAVSVITNVVETVPCGTV    141 - 210
PGSKELPCGERYSVAFFCLDTACVMIFTVEYLLRLFAAPSRYRFIRSVMSIIDVVAIMPYYIGLVMTNNE    211 - 280
DVSGAFVTLRVFRVFRIFKFSRHSQGLRILGYTLKSCASELGFLLFSLTMAIIIFATVMFYAEKGSSASK    281 - 350
FTSIPASFWYTIVTMTTLGYGDMVPKTIAGKIFGSICSLSGVLVIALPVPVIVSNFSRIYHQNQRADKRR    351 - 420
AQKKARLARIRVAKTGSSNAYLHSKRNGLLNEALELTGTPEEEHMGKTTSLIESQHHHLLHCLEKTTGLS    421 - 490
YLVDDPLLSVRTSTIKNHEFIDEQMFEQNCMESSMQNYPSTRSPSLSSHPGLTTTCCSRRSKKTTHLPNS    491 - 560
NLPATRLRSMQELSTIHIQGSEQPSLTTSRSSLNLKADDGLRPNCKTSQITTAIISIPTPPALTPEGESR    561 - 630
PPPASPGPNTNIPSIASNVVKVSAL                                                 631 - 655
//

Text Mined References (61)

PMID Year Title