Property Summary

NCBI Gene PubMed Count 60
Grant Count 112
R01 Count 72
Funding $10,609,138.26
PubMed Score 205.16
PubTator Score 208.07

Knowledge Summary

Patent (4,378)

Expression

  Differential Expression (20)

Disease log2 FC p
urothelial carcinoma -2.500 0.003
Parkinson's disease -1.300 0.030
malignant mesothelioma 1.800 0.000
astrocytic glioma -1.200 0.020
posterior fossa group A ependymoma -1.700 0.000
oligodendroglioma -1.500 0.026
glioblastoma -1.800 0.004
atypical teratoid / rhabdoid tumor -2.600 0.000
medulloblastoma, large-cell -3.700 0.000
lung cancer -1.300 0.006
colon cancer -2.100 0.000
active Crohn's disease 4.248 0.000
active ulcerative colitis 3.578 0.000
interstitial cystitis -1.100 0.044
adult high grade glioma -1.400 0.002
aldosterone-producing adenoma 1.975 0.015
lung carcinoma 4.000 0.000
progressive supranuclear palsy 1.400 0.027
ovarian cancer -1.600 0.000
pituitary cancer 1.800 0.000

Synonym

Accession Q9UK17 O60576 O60577 Q14D71 Q5T0M0 Q9UH85 Q9UH86 Q9UK16
Symbols KV4.3
SCA19
SCA22
BRGDA9
KCND3L
KCND3S
KSHIVB

Gene

PDB

1S1G   2NZ0  

Protein-protein Interaction (4)

Gene RIF (41)

PMID Text
26216464 Mefloquine is a concentration-dependent Ito and hKv4.3 channel blocker.
26016905 mutations cause a gainoffunction of KV4.3/KChIP2encoded channels by increasing membrane protein expression and slowing channel inactivation.
25854634 Altered Kv4.3 channel localization and/or functioning resulting from SCA19/22 mutations may lead to Purkinje cell loss, neurodegeneration and ataxia.
25600224 the interaction of DPP10a, expressed in human atrium, with Kv4.3 channels generates a sustained current component of Ito, which may affect late repolarization phase of atrial action potentials.
24963029 Demonstrate SEMA3A as a naturally occurring protein that selectively inhibits Kv4.3 and SEMA3A as a possible Brugada syndrome susceptibility gene through a Kv4.3 gain-of-function mechanism.
24845726 These results indicate that Kv4.3 is likely the target of discrepin and highlight the importance of the basic residue K13, located in the alpha-helix of the toxin, for current blockage.
24762397 Kv4.3 K(+) channel is involved in heart hypertrophy/heart failure independently of its electric function.[review]
23963749 findings indicate mutations in KCND3 are not a common cause of disease among rarer types of European cerebellar ataxia; however 2 variants were identified in the SCA cases: p.L450F and p.P614S; mutations in KCND3 can cause 2 allelic disorders, SCA19/22 and Brugada syndrome which may co-occur
23400760 Report a KV4.3 gain-of-function mutation in early-onset persistent lone atrial fibrillation.
23291429 The biophysical characteristics of Kv4.3 channels are strongly dependent on temperature.
More...

AA Sequence

MAAGVAAWLPFARAAAIGWMPVANCPMPLAPADKNKRQDELIVLNVSGRRFQTWRTTLERYPDTLLGSTE      1 - 70
KEFFFNEDTKEYFFDRDPEVFRCVLNFYRTGKLHYPRYECISAYDDELAFYGILPEIIGDCCYEEYKDRK     71 - 140
RENAERLMDDNDSENNQESMPSLSFRQTMWRAFENPHTSTLALVFYYVTGFFIAVSVITNVVETVPCGTV    141 - 210
PGSKELPCGERYSVAFFCLDTACVMIFTVEYLLRLFAAPSRYRFIRSVMSIIDVVAIMPYYIGLVMTNNE    211 - 280
DVSGAFVTLRVFRVFRIFKFSRHSQGLRILGYTLKSCASELGFLLFSLTMAIIIFATVMFYAEKGSSASK    281 - 350
FTSIPASFWYTIVTMTTLGYGDMVPKTIAGKIFGSICSLSGVLVIALPVPVIVSNFSRIYHQNQRADKRR    351 - 420
AQKKARLARIRVAKTGSSNAYLHSKRNGLLNEALELTGTPEEEHMGKTTSLIESQHHHLLHCLEKTTGLS    421 - 490
YLVDDPLLSVRTSTIKNHEFIDEQMFEQNCMESSMQNYPSTRSPSLSSHPGLTTTCCSRRSKKTTHLPNS    491 - 560
NLPATRLRSMQELSTIHIQGSEQPSLTTSRSSLNLKADDGLRPNCKTSQITTAIISIPTPPALTPEGESR    561 - 630
PPPASPGPNTNIPSIASNVVKVSAL                                                 631 - 655
//

Publication (60)

PMID Year Title
26216464 2015 Modulation of the transient outward current (Ito) in rat cardiac myocytes and human Kv4.3 channels by mefloquine.
26016905 2015 Two novel Brugada syndrome-associated mutations increase KV4.3 membrane expression and function.
25854634 2015 Spinocerebellar ataxia type 19/22 mutations alter heterocomplex Kv4.3 channel function and gating in a dominant manner.
25600224 2015 Interaction of DPP10a with Kv4.3 channel complex results in a sustained current component of human transient outward current Ito.
24963029 2014 Characterization of SEMA3A-encoded semaphorin as a naturally occurring Kv4.3 protein inhibitor and its contribution to Brugada syndrome.
24850809 2014 Genetic determinants of P wave duration and PR segment.
24845726 2014 Interaction of the scorpion toxin discrepin with Kv4.3 channels and A-type K(+) channels in cerebellum granular cells.
24785509 2014 A genome wide association study (GWAS) providing evidence of an association between common genetic variants and late radiotherapy toxicity.
24762397 2014 The potential role of Kv4.3 K+ channel in heart hypertrophy.
23963749 2013 The L450F [Corrected] mutation in KCND3 brings spinocerebellar ataxia and Brugada syndrome closer together.
More...