Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.50
PubTator Score 1.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
tuberculosis 2010 4.2e-06
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Common cold 69 3.316 1.7

Expression

  Differential Expression (1)

Disease log2 FC p
tuberculosis -1.200 4.2e-06

AA Sequence

MAKLYEAVTFKDVAVIFTEEELGLLDPAQRKLYRDVMLENFRNLLSVGGKIQTEMETVPEAGTHEEFSCK      1 - 70
QIWEQIASDLTRSQDTTISNSQLFEQDDNPSQIKARLSTVHTREKPFQGENCKQFFSDVSFFDLPQQLYS     71 - 140
GEKSHTCDECGKSFCYISALHIHQRVHMGVKCYKCDVCGKEFSQSSRLQTHQRVHTGEKPFKCEQCGKGF    141 - 210
RCRSALKVHCKLHMREKPYNCEKCGKAFMHNFQLQKHHRIHTGEKPFKCEICGKSFCLRSSLNRHCMVHT    211 - 280
AEKLYKSEKYGRGFIDRLDLHKHQMIHMGQKPYNCKECGKSFKWSSYLLVHQRVHTGEKPYKCEECGKGY    281 - 350
ISKSGLDFHHRTHTGERSYNCDNCGKSFRHASSILNHKKLHCQRKPLKCEDCGKRLVCRSYCKDQQRDHS    351 - 420
GENPSKCEDCGKRYKRRLNLDIILSLFLNDI                                           421 - 451
//

Text Mined References (8)

PMID Year Title