Property Summary

NCBI Gene PubMed Count 56
Grant Count 25
R01 Count 13
Funding $1,888,433.06
PubMed Score 139.52
PubTator Score 67.17

Knowledge Summary

Patent

No data available

Gene RIF (49)

PMID Text
26678910 In ovarian and breast epithelial cells, epigenetic regulation of GDF2 suppresses anoikis.
26677222 Data suggest ALK1 and ACVR2A/ACVR2B, acting as BMP9 co-receptors, rearrange pro-domains of BMP9--pro-domain dimer complex leading to displacement of pro-domains after receptor binding, release of mature non-dimer BPM9, and activation of signaling.
26645636 IGF1 can enhance BMP9-induced osteogenic differentiation in mesenchymal stem cells.
26609524 BMP9 also influenced the expression of PPARgamma.
26471266 DLL4/Notch1 and BMP9 interdependent signaling induces endothelial cell quiescence via P27KIP1/thrombospondin pathway.
25909848 BMP9 Crosstalk with the Hippo Pathway Regulates Endothelial Cell Matricellular and Chemokine Responses
25751889 structural analysis of the bone morphogenetic protein 9 procomplex
25393508 This review summarizes the indirect connection between BMP9 and liver fibrosis, with a focus on the BMP9 signaling pathway members ALK1, endoglin, Id1, hepcidin and Snail. [review]
25297851 BMP-9 induces vascular smooth muscle cell osteogenic differentiation and calcification via ALK1, Smad and ALP dependent mechanisms.
25237187 BMP9 is regulated by redox-dependent proteolysis
More...

AA Sequence

MCPGALWVALPLLSLLAGSLQGKPLQSWGRGSAGGNAHSPLGVPGGGLPEHTFNLKMFLENVKVDFLRSL      1 - 70
NLSGVPSQDKTRVEPPQYMIDLYNRYTSDKSTTPASNIVRSFSMEDAISITATEDFPFQKHILLFNISIP     71 - 140
RHEQITRAELRLYVSCQNHVDPSHDLKGSVVIYDVLDGTDAWDSATETKTFLVSQDIQDEGWETLEVSSA    141 - 210
VKRWVRSDSTKSKNKLEVTVESHRKGCDTLDISVPPGSRNLPFFVVFSNDHSSGTKETRLELREMISHEQ    211 - 280
ESVLKKLSKDGSTEAGESSHEEDTDGHVAAGSTLARRKRSAGAGSHCQKTSLRVNFEDIGWDSWIIAPKE    281 - 350
YEAYECKGGCFFPLADDVTPTKHAIVQTLVHLKFPTKVGKACCVPTKLSPISVLYKDDMGVPTLKYHYEG    351 - 420
MSVAECGCR                                                                 421 - 429
//

Text Mined References (60)

PMID Year Title
26678910 2015 Epigenetic Regulation of GDF2 Suppresses Anoikis in Ovarian and Breast Epithelia.
26677222 2016 Rapid Activation of Bone Morphogenic Protein 9 by Receptor-mediated Displacement of Pro-domains.
26645636 2016 IGF1 potentiates BMP9-induced osteogenic differentiation in mesenchymal stem cells through the enhancement of BMP/Smad signaling.
26609524 2015 Synergistic Effects of BMP9 and miR-548d-5p on Promoting Osteogenic Differentiation of Mesenchymal Stem Cells.
26471266 2015 DLL4/Notch1 and BMP9 Interdependent Signaling Induces Human Endothelial Cell Quiescence via P27KIP1 and Thrombospondin-1.
25909848 2015 BMP9 Crosstalk with the Hippo Pathway Regulates Endothelial Cell Matricellular and Chemokine Responses.
25751889 2015 Structure of bone morphogenetic protein 9 procomplex.
25393508 2014 Potential roles of BMP9 in liver fibrosis.
25297851 2015 BMP-9 regulates the osteoblastic differentiation and calcification of vascular smooth muscle cells through an ALK1 mediated pathway.
25237187 2014 Regulation of bone morphogenetic protein 9 (BMP9) by redox-dependent proteolysis.
More...