Property Summary

NCBI Gene PubMed Count 66
PubMed Score 176.44
PubTator Score 67.17

Knowledge Summary

Patent

No data available

Gene RIF (59)

AA Sequence

MCPGALWVALPLLSLLAGSLQGKPLQSWGRGSAGGNAHSPLGVPGGGLPEHTFNLKMFLENVKVDFLRSL      1 - 70
NLSGVPSQDKTRVEPPQYMIDLYNRYTSDKSTTPASNIVRSFSMEDAISITATEDFPFQKHILLFNISIP     71 - 140
RHEQITRAELRLYVSCQNHVDPSHDLKGSVVIYDVLDGTDAWDSATETKTFLVSQDIQDEGWETLEVSSA    141 - 210
VKRWVRSDSTKSKNKLEVTVESHRKGCDTLDISVPPGSRNLPFFVVFSNDHSSGTKETRLELREMISHEQ    211 - 280
ESVLKKLSKDGSTEAGESSHEEDTDGHVAAGSTLARRKRSAGAGSHCQKTSLRVNFEDIGWDSWIIAPKE    281 - 350
YEAYECKGGCFFPLADDVTPTKHAIVQTLVHLKFPTKVGKACCVPTKLSPISVLYKDDMGVPTLKYHYEG    351 - 420
MSVAECGCR                                                                 421 - 429
//

Text Mined References (71)

PMID Year Title