Property Summary

NCBI Gene PubMed Count 5
PubMed Score 55.03
PubTator Score 48.37

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (2)

Disease log2 FC p
intraductal papillary-mucinous neoplasm ... -1.100 1.4e-02
malignant mesothelioma -3.000 9.1e-09

Gene RIF (1)

AA Sequence

MNSRTASARGWFSSRPPTSESDLEPATDGPASETTTLSPEATTFNDTRIPDAAGGTAGVGTMLLSFGIIT      1 - 70
VIGLAVALVLYIRKKKRLEKLRHQLMPMYNFDPTEEQDELEQELLEHGRDAASVQAATSVQAMQGKTTLP     71 - 140
SQGPLQRPSRLVFTDVANAIHA                                                    141 - 162
//

Text Mined References (8)

PMID Year Title