Property Summary

NCBI Gene PubMed Count 5
PubMed Score 54.06
PubTator Score 48.37

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
malignant mesothelioma -3.000 0.000
intraductal papillary-mucinous neoplasm ... -1.100 0.014

Gene RIF (1)

PMID Text
20205591 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MNSRTASARGWFSSRPPTSESDLEPATDGPASETTTLSPEATTFNDTRIPDAAGGTAGVGTMLLSFGIIT      1 - 70
VIGLAVALVLYIRKKKRLEKLRHQLMPMYNFDPTEEQDELEQELLEHGRDAASVQAATSVQAMQGKTTLP     71 - 140
SQGPLQRPSRLVFTDVANAIHA                                                    141 - 162
//

Text Mined References (8)

PMID Year Title
20205591 2010 Host determinants of HIV-1 control in African Americans.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.