Property Summary

NCBI Gene PubMed Count 5
PubMed Score 54.06
PubTator Score 48.37

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
malignant mesothelioma 3163 9.10997678388361E-9
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0137191974480292
Disease Target Count Z-score Confidence
Saethre-Chotzen syndrome 9 3.336 1.7

Expression

  Differential Expression (2)

Disease log2 FC p
malignant mesothelioma -3.000 0.000
intraductal papillary-mucinous neoplasm ... -1.100 0.014

Synonym

Accession Q9UK00 C9JNP0
Symbols G20

Gene

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG

Gene RIF (1)

PMID Text
20205591 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MNSRTASARGWFSSRPPTSESDLEPATDGPASETTTLSPEATTFNDTRIPDAAGGTAGVGTMLLSFGIIT      1 - 70
VIGLAVALVLYIRKKKRLEKLRHQLMPMYNFDPTEEQDELEQELLEHGRDAASVQAATSVQAMQGKTTLP     71 - 140
SQGPLQRPSRLVFTDVANAIHA                                                    141 - 162
//

Text Mined References (8)

PMID Year Title
20205591 2010 Host determinants of HIV-1 control in African Americans.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.