Property Summary

NCBI Gene PubMed Count 40
PubMed Score 8.30
PubTator Score 50.78

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
Multiple myeloma 1.316 0.002
pancreatic ductal adenocarcinoma liver m... -1.697 0.009
lung cancer 1.900 0.000
diabetes mellitus -1.100 0.001
non primary Sjogren syndrome sicca 1.500 0.023
ovarian cancer 1.200 0.005

Synonym

Accession Q9UJZ1 B4E1K7 D3DRN3 O60376 Q53G29 Q96FY2 Q9P042 SLP-2
Symbols SLP-2
HSPC108

Gene

PANTHER Protein Class (1)

Gene RIF (30)

PMID Text
26750533 The significant association of SLP-2 overexpression with unfavorable clinicopathological characteristics and BRAFV600E mutation indicates that SLP-2 may have a role in aggressiveness of BRAF-mutated papillary thyroid carcinoma.
26487491 Stomatin-like protein 2 is overexpressed in epithelial ovarian cancer and predicts poor patient survival
25973071 STOML2 was correlated to progression in cervical cancer, and implicated it as a potential predictive factor for the prognosis of cervical cancer.
25695396 Our study showed that STOML-2 was negatively regulated by miR1207-5p in esophageal carcinoma
24258357 STOML2 may have a role in progression of gastric adenocarcinoma
24190591 SLP-2 was upregulated by TGF-beta1, indicating a possible role of SLP-2 in Papillary thyroid cancer tumorigenesis.
23918306 SLP-2 may play an important role in human GBC tumorigenesis, and SLP-2 might serve as a novel prognostic marker in human GBC.
23874603 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of stomatin (EPB72)-like 2 (STOML2) expression by HIV-1 Vpr in Vpr transduced macrophages
23667687 Expression of SLP-2 is associated with invasion of esophageal squamous cell carcinoma.
23371255 Increased levels of SLP-2 correlate with lymph node metastasis in gastric cancer.
More...

AA Sequence

MLARAARGTGALLLRGSLLASGRAPRRASSGLPRNTVVLFVPQQEAWVVERMGRFHRILEPGLNILIPVL      1 - 70
DRIRYVQSLKEIVINVPEQSAVTLDNVTLQIDGVLYLRIMDPYKASYGVEDPEYAVTQLAQTTMRSELGK     71 - 140
LSLDKVFRERESLNASIVDAINQAADCWGIRCLRYEIKDIHVPPRVKESMQMQVEAERRKRATVLESEGT    141 - 210
RESAINVAEGKKQAQILASEAEKAEQINQAAGEASAVLAKAKAKAEAIRILAAALTQHNGDAAASLTVAE    211 - 280
QYVSAFSKLAKDSNTILLPSNPGDVTSMVAQAMGVYGALTKAPVPGTPDSLSSGSSRDVQGTDASLDEEL    281 - 350
DRVKMS                                                                    351 - 356
//

Text Mined References (49)

PMID Year Title
26750533 2016 Stomatin-like protein 2 overexpression in papillary thyroid carcinoma is significantly associated with high-risk clinicopathological parameters and BRAFV600E mutation.
26487491 2015 Stomatin-like protein 2 is overexpressed in epithelial ovarian cancer and predicts poor patient survival.
25973071 2015 Stomatin-like protein 2 expression is associated with clinical survival in patients with cervical cancer.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25695396 2015 miRNA-1207-5p is associated with cancer progression by targeting stomatin-like protein 2 in esophageal carcinoma.
24337748 2014 Guanylate binding protein 1-mediated interaction of T cell antigen receptor signaling with the cytoskeleton.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24258357 2014 Increased expression of stomatin-like protein 2 (STOML2) predicts decreased survival in gastric adenocarcinoma: a retrospective study.
24190591 2014 Stomatin-like protein 2 is associated with the clinicopathological features of human papillary thyroid cancer and is regulated by TGF-? in thyroid cancer cells.
23918306 2014 Clinicopathological significance of SLP-2 overexpression in human gallbladder cancer.
More...