Property Summary

NCBI Gene PubMed Count 63
Grant Count 36
R01 Count 24
Funding $3,504,441.32
PubMed Score 78.67
PubTator Score 44.12

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
ependymoma 1.200 0.010
oligodendroglioma 1.500 0.008
psoriasis 2.200 0.000
osteosarcoma 2.923 0.000
astrocytoma 1.400 0.004
primitive neuroectodermal tumor 1.200 0.009
sarcoidosis -1.100 0.029
group 4 medulloblastoma 1.100 0.037
ovarian cancer -1.400 0.001

Gene RIF (31)

PMID Text
25496667 Genome-wide shRNA screening identifies GGA1, which is required for HIV-1 Nef-induced downregulation of CD4 in HeLa CD4+ cells
24866237 These findings show that the AD-like phenotype of NPC model cells can be partly reverted by promoting a non-amyloidogenic processing of APP through the upregulation of GGA1 supporting its preventive role against AD
24407285 These data indicate that clathrin is required for the function of AP-1- and GGA-coated carriers at the trans-Golgi network but may be dispensable for outward traffic en route to the plasma membrane.
22621900 On basis of these results, propose that GGA1 facilitates LR11 endocytic traffic and that LR11 modulates A-beta levels by promoting amyloid-beta precursor protein traffic to the endocytic recycling compartment
22004035 Genome-wide shRNA screening identifies GGA1, which is required for HIV-1 Nef-induced downregulation of CD4 in HeLa CD4+ cells
21841072 Genome-wide shRNA screening identifies GGA1, which is required for HIV-1 Nef-induced downregulation of CD4 in HeLa CD4+ cells
20012524 Genome-wide shRNA screening identifies GGA1, which is required for HIV-1 Nef-induced downregulation of CD4 in HeLa CD4+ cells
20012524 Genome-wide shRNA screening identifies GGA1, which is required for HIV-1 Nef-induced downregulation of CD4 in HeLa CD4+ cells
19788741 GGA overexpression causes various sorting defects as measured by recycling of CD-MPR, internalization of transferrin receptor, and the subcellular localization of proteins like Tsg101, ubiquitin, and Hrs.
19788741 Genome-wide shRNA screening identifies GGA1, which is required for HIV-1 Nef-induced downregulation of CD4 in HeLa CD4+ cells
More...

AA Sequence

MEPAMEPETLEARINRATNPLNKELDWASINGFCEQLNEDFEGPPLATRLLAHKIQSPQEWEAIQALTVL      1 - 70
ETCMKSCGKRFHDEVGKFRFLNELIKVVSPKYLGSRTSEKVKNKILELLYSWTVGLPEEVKIAEAYQMLK     71 - 140
KQGIVKSDPKLPDDTTFPLPPPRPKNVIFEDEEKSKMLARLLKSSHPEDLRAANKLIKEMVQEDQKRMEK    141 - 210
ISKRVNAIEEVNNNVKLLTEMVMSHSQGGAAAGSSEDLMKELYQRCERMRPTLFRLASDTEDNDEALAEI    211 - 280
LQANDNLTQVINLYKQLVRGEEVNGDATAGSIPGSTSALLDLSGLDLPPAGTTYPAMPTRPGEQASPEQP    281 - 350
SASVSLLDDELMSLGLSDPTPPSGPSLDGTGWNSFQSSDATEPPAPALAQAPSMESRPPAQTSLPASSGL    351 - 420
DDLDLLGKTLLQQSLPPESQQVRWEKQQPTPRLTLRDLQNKSSSCSSPSSSATSLLHTVSPEPPRPPQQP    421 - 490
VPTELSLASITVPLESIKPSNILPVTVYDQHGFRILFHFARDPLPGRSDVLVVVVSMLSTAPQPIRNIVF    491 - 560
QSAVPKVMKVKLQPPSGTELPAFNPIVHPSAITQVLLLANPQKEKVRLRYKLTFTMGDQTYNEMGDVDQF    561 - 630
PPPETWGSL                                                                 631 - 639
//

Text Mined References (72)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24866237 2014 GGA1 overexpression attenuates amyloidogenic processing of the amyloid precursor protein in Niemann-Pick type C cells.
24407285 2014 Clathrin terminal domain-ligand interactions regulate sorting of mannose 6-phosphate receptors mediated by AP-1 and GGA adaptors.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22621900 2012 GGA1-mediated endocytic traffic of LR11/SorLA alters APP intracellular distribution and amyloid-? production.
22522702 2012 Structural basis for Arf6-MKLP1 complex formation on the Flemming body responsible for cytokinesis.
21269460 2011 Initial characterization of the human central proteome.
20676133 2010 Multiple modification and protein interaction signals drive the Ring finger protein 11 (RNF11) E3 ligase to the endosomal compartment.
More...