Property Summary

NCBI Gene PubMed Count 63
PubMed Score 81.73
PubTator Score 44.12

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytoma 1.400 3.7e-03
ependymoma 1.200 1.0e-02
group 4 medulloblastoma 1.100 3.7e-02
oligodendroglioma 1.500 7.8e-03
osteosarcoma 2.923 1.0e-05
ovarian cancer -1.400 9.5e-04
primitive neuroectodermal tumor 1.200 9.2e-03
psoriasis 1.600 8.6e-05
sarcoidosis -1.100 2.9e-02

Gene RIF (28)

AA Sequence

MEPAMEPETLEARINRATNPLNKELDWASINGFCEQLNEDFEGPPLATRLLAHKIQSPQEWEAIQALTVL      1 - 70
ETCMKSCGKRFHDEVGKFRFLNELIKVVSPKYLGSRTSEKVKNKILELLYSWTVGLPEEVKIAEAYQMLK     71 - 140
KQGIVKSDPKLPDDTTFPLPPPRPKNVIFEDEEKSKMLARLLKSSHPEDLRAANKLIKEMVQEDQKRMEK    141 - 210
ISKRVNAIEEVNNNVKLLTEMVMSHSQGGAAAGSSEDLMKELYQRCERMRPTLFRLASDTEDNDEALAEI    211 - 280
LQANDNLTQVINLYKQLVRGEEVNGDATAGSIPGSTSALLDLSGLDLPPAGTTYPAMPTRPGEQASPEQP    281 - 350
SASVSLLDDELMSLGLSDPTPPSGPSLDGTGWNSFQSSDATEPPAPALAQAPSMESRPPAQTSLPASSGL    351 - 420
DDLDLLGKTLLQQSLPPESQQVRWEKQQPTPRLTLRDLQNKSSSCSSPSSSATSLLHTVSPEPPRPPQQP    421 - 490
VPTELSLASITVPLESIKPSNILPVTVYDQHGFRILFHFARDPLPGRSDVLVVVVSMLSTAPQPIRNIVF    491 - 560
QSAVPKVMKVKLQPPSGTELPAFNPIVHPSAITQVLLLANPQKEKVRLRYKLTFTMGDQTYNEMGDVDQF    561 - 630
PPPETWGSL                                                                 631 - 639
//

Text Mined References (72)

PMID Year Title