Property Summary

NCBI Gene PubMed Count 42
PubMed Score 25.19
PubTator Score 21.79

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
non-small cell lung cancer 2798 1.69559578183766E-21
tuberculosis 1563 6.30313593985867E-9
osteosarcoma 7933 5.45660073934572E-8
malignant mesothelioma 3163 1.60564639542336E-7
atypical teratoid / rhabdoid tumor 4369 1.27435148683988E-5
medulloblastoma, large-cell 6234 5.62969805797087E-5
psoriasis 6685 7.58161240306916E-5
ovarian cancer 8492 7.04363946063007E-4
dermatomyositis 967 9.4866418752623E-4
diabetes mellitus 1663 0.00121006559216321
COPD 116 0.00459210598794321
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0204109246081243
subependymal giant cell astrocytoma 2287 0.0219675929636466
pancreatic cancer 2300 0.0263102082918331
pancreatic carcinoma 567 0.0263102082918331
lung cancer 4473 0.0395696026514791
ileal Crohn's disease 9 0.0425865597051845
primary pancreatic ductal adenocarcinoma 1271 0.0454910988319309

Expression

  Differential Expression (18)

Disease log2 FC p
pancreatic cancer -1.100 0.026
malignant mesothelioma 2.000 0.000
psoriasis -2.600 0.000
osteosarcoma -2.397 0.000
atypical teratoid / rhabdoid tumor 1.200 0.000
medulloblastoma, large-cell 1.400 0.000
tuberculosis -1.700 0.000
primary pancreatic ductal adenocarcinoma -1.071 0.045
non-small cell lung cancer -1.167 0.000
intraductal papillary-mucinous neoplasm ... -1.200 0.020
lung cancer -1.200 0.040
diabetes mellitus -1.100 0.001
pancreatic carcinoma -1.100 0.026
subependymal giant cell astrocytoma 1.503 0.022
COPD -1.100 0.005
ovarian cancer 1.500 0.001
ileal Crohn's disease -1.023 0.043
dermatomyositis 1.100 0.001

Synonym

Accession Q9UJY4 D3DWF0 O14564 Q9NYN2 Q9UPS2
Symbols VEAR

Gene

PDB

1MHQ  

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Fruitfly EggNOG Inparanoid
S.cerevisiae OMA EggNOG

Gene RIF (13)

PMID Text
25496667 Genome-wide shRNA screening identifies GGA2, which is required for HIV-1 Nef-induced downregulation of CD4 in HeLa CD4+ cells
24407285 These data indicate that clathrin is required for the function of AP-1- and GGA-coated carriers at the trans-Golgi network but may be dispensable for outward traffic en route to the plasma membrane.
22291915 GGA2 mediates a vital function that cannot be compensated for by GGA1and/or GGA3.
20012524 Genome-wide shRNA screening identifies GGA2, which is required for HIV-1 Nef-induced downregulation of CD4 in HeLa CD4+ cells
19788741 GGA overexpression causes various sorting defects as measured by recycling of CD-MPR, internalization of transferrin receptor, and the subcellular localization of proteins like Tsg101, ubiquitin, and Hrs.
18638397 Genome-wide shRNA screening identifies GGA2, which is required for HIV-1 Nef-induced downregulation of CD4 in HeLa CD4+ cells
18439901 Genome-wide shRNA screening identifies GGA2, which is required for HIV-1 Nef-induced downregulation of CD4 in HeLa CD4+ cells
18431031 GGA2 is recruited to the trans-Golgi network independently of the other Golgi-localized, gamma-ear-containing, ARF-binding proteins and is required for the efficient sorting of lysosomal enzymes
17596511 p56 tightly cooperates with the GGAs in the sorting of cathepsin D to lysosomes, probably by enabling the movement of GGA-containing transport carriers.
17494868 These results show that the dual roles of PI4P can promote specific GGA targeting and cargo recognition at the trans-Golgi network.
More...

AA Sequence

MAATAVAAAVAGTESAQGPPGPAASLELWLNKATDPSMSEQDWSAIQNFCEQVNTDPNGPTHAPWLLAHK      1 - 70
IQSPQEKEALYALTVLEMCMNHCGEKFHSEVAKFRFLNELIKVLSPKYLGSWATGKVKGRVIEILFSWTV     71 - 140
WFPEDIKIRDAYQMLKKQGIIKQDPKLPVDKILPPPSPWPKSSIFDADEEKSKLLTRLLKSNHPEDLQAA    141 - 210
NRLIKNLVKEEQEKSEKVSKRVSAVEEVRSHVKVLQEMLSMYRRPGQAPPDQEALQVVYERCEKLRPTLF    211 - 280
RLASDTTDDDDALAEILQANDLLTQGVLLYKQVMEGRVTFGNRVTSSLGDIPVSRVFQNPAGCMKTCPLI    281 - 350
DLEVDNGPAQMGTVVPSLLHQDLAALGISDAPVTGMVSGQNCCEEKRNPSSSTLPGGGVQNPSADRNLLD    351 - 420
LLSAQPAPCPLNYVSQKSVPKEVPPGTKSSPGWSWEAGPLAPSPSSQNTPLAQVFVPLESVKPSSLPPLI    421 - 490
VYDRNGFRILLHFSQTGAPGHPEVQVLLLTMMSTAPQPVWDIMFQVAVPKSMRVKLQPASSSKLPAFSPL    491 - 560
MPPAVISQMLLLDNPHKEPIRLRYKLTFNQGGQPFSEVGEVKDFPDLAVLGAA                     561 - 613
//

Text Mined References (46)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
24407285 2014 Clathrin terminal domain-ligand interactions regulate sorting of mannose 6-phosphate receptors mediated by AP-1 and GGA adaptors.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22291915 2012 Analysis of Gga null mice demonstrates a non-redundant role for mammalian GGA2 during development.
21269460 2011 Initial characterization of the human central proteome.
19788741 2009 Defects in cellular sorting and retroviral assembly induced by GGA overexpression.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19478182 2009 A role for the CHC22 clathrin heavy-chain isoform in human glucose metabolism.
18431031 2007 Specific depletion of GGA2 causes cathepsin D missorting in HeLa cells.
More...