Property Summary

NCBI Gene PubMed Count 43
PubMed Score 25.56
PubTator Score 21.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.200 1.3e-05
COPD -1.100 4.6e-03
dermatomyositis 1.100 9.5e-04
diabetes mellitus -1.100 1.2e-03
ileal Crohn's disease -1.023 4.3e-02
intraductal papillary-mucinous neoplasm ... -1.200 2.0e-02
lung cancer -1.200 4.0e-02
malignant mesothelioma 1.700 3.1e-07
medulloblastoma, large-cell 1.400 5.6e-05
non-small cell lung cancer -1.167 1.7e-21
osteosarcoma -2.397 5.5e-08
ovarian cancer 1.500 7.0e-04
pancreatic cancer -1.100 2.6e-02
pancreatic carcinoma -1.100 2.6e-02
primary pancreatic ductal adenocarcinoma -1.071 4.5e-02
psoriasis -2.600 7.6e-05
subependymal giant cell astrocytoma 1.503 2.2e-02
tuberculosis -1.700 6.3e-09

Protein-protein Interaction (5)

Gene RIF (13)

AA Sequence

MAATAVAAAVAGTESAQGPPGPAASLELWLNKATDPSMSEQDWSAIQNFCEQVNTDPNGPTHAPWLLAHK      1 - 70
IQSPQEKEALYALTVLEMCMNHCGEKFHSEVAKFRFLNELIKVLSPKYLGSWATGKVKGRVIEILFSWTV     71 - 140
WFPEDIKIRDAYQMLKKQGIIKQDPKLPVDKILPPPSPWPKSSIFDADEEKSKLLTRLLKSNHPEDLQAA    141 - 210
NRLIKNLVKEEQEKSEKVSKRVSAVEEVRSHVKVLQEMLSMYRRPGQAPPDQEALQVVYERCEKLRPTLF    211 - 280
RLASDTTDDDDALAEILQANDLLTQGVLLYKQVMEGRVTFGNRVTSSLGDIPVSRVFQNPAGCMKTCPLI    281 - 350
DLEVDNGPAQMGTVVPSLLHQDLAALGISDAPVTGMVSGQNCCEEKRNPSSSTLPGGGVQNPSADRNLLD    351 - 420
LLSAQPAPCPLNYVSQKSVPKEVPPGTKSSPGWSWEAGPLAPSPSSQNTPLAQVFVPLESVKPSSLPPLI    421 - 490
VYDRNGFRILLHFSQTGAPGHPEVQVLLLTMMSTAPQPVWDIMFQVAVPKSMRVKLQPASSSKLPAFSPL    491 - 560
MPPAVISQMLLLDNPHKEPIRLRYKLTFNQGGQPFSEVGEVKDFPDLAVLGAA                     561 - 613
//

Text Mined References (47)

PMID Year Title