Property Summary

NCBI Gene PubMed Count 86
PubMed Score 228.51
PubTator Score 95.19

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (6)

Disease Target Count P-value
lung adenocarcinoma 2714 1.47832476327704E-17
non-small cell lung cancer 2798 8.1114123529327E-16
colon cancer 1475 2.71557228869164E-10
lung carcinoma 2844 7.58864140559111E-10
sonic hedgehog group medulloblastoma 1482 7.84064776130666E-9
atypical teratoid/rhabdoid tumor 1095 5.73918045707783E-8
ovarian cancer 8492 9.00574259339463E-8
malignant mesothelioma 3163 1.91388424942448E-6
lung cancer 4473 3.10672703560519E-6
cystic fibrosis 1670 5.42104801845693E-6
psoriasis 6685 2.89812969521415E-4
Atopic dermatitis 944 0.00104205118806177
nasopharyngeal carcinoma 1056 0.00115629831865021
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00121267059019165
medulloblastoma, large-cell 6234 0.00154546624886923
Breast cancer 3099 0.00529103318622344
ependymoma 2514 0.006153573458203
osteosarcoma 7933 0.00758822043969423
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0120856538679899
glioblastoma 5572 0.0151723360093044
chronic kidney disease 90 0.0172877896349464
ductal carcinoma in situ 1745 0.0194451178002455
esophageal adenocarcinoma 737 0.0199506266302449
adrenocortical carcinoma 1427 0.0233837234815726
invasive ductal carcinoma 2950 0.0246985411975756
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.028592538709594
non primary Sjogren syndrome sicca 840 0.0311549916821802
spina bifida 1064 0.0373936224288373
oligodendroglioma 2849 0.041088966486919
Disease Target Count Z-score Confidence
Myopathy 128 3.112 1.6
Amyotrophic Lateral Sclerosis 432 3.086 1.5

Expression

  Differential Expression (29)

Synonym

Accession Q9UJY1 B2R6A6 Q6FIH3 Q9UKS3 HspB8
Symbols H11
HMN2
CMT2L
DHMN2
E2IG1
HMN2A
HSP22

Gene

PANTHER Protein Class (1)

  Ortholog (11)

Pathway (1)

Gene RIF (52)

PMID Text
26718575 expands the understanding of disease mechanisms, tissue involvement, and phenotypic outcome of HSPB8 mutations
26694816 This study demonstreated that expression of HSPB8 was restricted to GFAP+ astrocytes in patient with multiple sclerosis.
26496431 our findings suggest the existence of a so-far unrecognized quality control mechanism involving BAG3, HSPB8 and p62/SQSTM1 for accurate remodelling of actin-based mitotic structures that guide spindle orientation.
25731856 HSP22 acts as a positive regulator in TGF-alpha-induced migration of ovarian cancer cells, subsequently directing ovarian cancer toward progression.
25051369 Pangenomic profiling of velcade-sensitive and resistant cells showed that the small heat shock protein HSPB8 was overexpressed in multiple myeloma resistant cells.
24804817 HSP22 plays an important role on gastric tumor aggressiveness and prognosis and may act as a promising target for prognostic prediction.
22898869 The expression of HspB8 inhibits the growth of genetically diverse melanoma cells that include caspase-1 activation outside of the realm of the inflammasome, mTORC1-dependent Beclin-1 upregulation and its cleavage by the activated caspase-1.
22595202 Mutant HSPB8 causes protein aggregates and a reduced mitochondrial membrane potential in dermal fibroblasts from distal hereditary motor neuropathy patients.
22302993 findings show that during heat shock recovery NF-kappaB activates selective removal of misfolded or aggregated proteins by controlling expression of BAG3 and HSPB8 and by modulating the level of the BAG3-HspB8 complex
22176143 We studied the HSPB1 and HSPB8 mutation occurrence in patients with distal hereditary motor neuropathy and those with the axonal form of Charcot-Marie-Tooth disease type 2
More...

AA Sequence

MADGQMPFSCHYPSRLRRDPFRDSPLSSRLLDDGFGMDPFPDDLTASWPDWALPRLSSAWPGTLRSGMVP      1 - 70
RGPTATARFGVPAEGRTPPPFPGEPWKVCVNVHSFKPEELMVKTKDGYVEVSGKHEEKQQEGGIVSKNFT     71 - 140
KKIQLPAEVDPVTVFASLSPEGLLIIEAPQVPPYSTFGESSFNNELPQDSQEVTCT                  141 - 196
//

Text Mined References (90)

PMID Year Title
26718575 2016 Mutations in HSPB8 causing a new phenotype of distal myopathy and motor neuropathy.
26694816 2015 Small heat shock proteins are induced during multiple sclerosis lesion development in white but not grey matter.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26496431 2015 A Role for the Chaperone Complex BAG3-HSPB8 in Actin Dynamics, Spindle Orientation and Proper Chromosome Segregation during Mitosis.
25731856 2015 Regulation by heat shock protein 22 (HSPB8) of transforming growth factor-?-induced ovary cancer cell migration.
25416956 2014 A proteome-scale map of the human interactome network.
25051369 2014 The small heat shock protein B8 (HSPB8) confers resistance to bortezomib by promoting autophagic removal of misfolded proteins in multiple myeloma cells.
25036637 2014 A quantitative chaperone interaction network reveals the architecture of cellular protein homeostasis pathways.
24804817 2014 Heat shock protein 22 overexpression is associated with the progression and prognosis in gastric cancer.
24324551 2013 Genome wide association study (GWAS) of Chagas cardiomyopathy in Trypanosoma cruzi seropositive subjects.
More...