Property Summary

NCBI Gene PubMed Count 91
PubMed Score 247.44
PubTator Score 95.19

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Expression

  Differential Expression (29)

Disease log2 FC p
adrenocortical carcinoma 1.967 2.3e-02
Atopic dermatitis -1.100 1.0e-03
atypical teratoid / rhabdoid tumor -2.900 6.4e-06
Breast cancer -1.600 5.3e-03
chronic kidney disease 1.300 1.7e-02
colon cancer -2.900 2.7e-10
cystic fibrosis -2.604 5.4e-06
ductal carcinoma in situ -1.200 1.9e-02
ependymoma 2.400 6.2e-03
esophageal adenocarcinoma -2.800 2.0e-02
glioblastoma -1.100 1.5e-02
group 3 medulloblastoma -2.000 1.2e-03
intraductal papillary-mucinous adenoma (... -2.000 1.2e-03
intraductal papillary-mucinous carcinoma... -1.500 2.9e-02
intraductal papillary-mucinous neoplasm ... -2.100 1.2e-02
invasive ductal carcinoma -1.126 3.6e-02
lung adenocarcinoma -1.700 5.5e-13
lung cancer -1.500 2.2e-03
lung carcinoma -1.500 7.6e-10
malignant mesothelioma -1.100 1.9e-06
medulloblastoma, large-cell -2.900 1.5e-03
nasopharyngeal carcinoma -2.200 1.2e-03
non primary Sjogren syndrome sicca 1.100 3.1e-02
non-small cell lung cancer -1.900 8.1e-16
oligodendroglioma 1.700 4.1e-02
osteosarcoma 2.765 7.6e-03
ovarian cancer -2.400 9.0e-08
psoriasis 2.500 2.9e-04
spina bifida -2.098 3.7e-02

Gene RIF (56)

AA Sequence

MADGQMPFSCHYPSRLRRDPFRDSPLSSRLLDDGFGMDPFPDDLTASWPDWALPRLSSAWPGTLRSGMVP      1 - 70
RGPTATARFGVPAEGRTPPPFPGEPWKVCVNVHSFKPEELMVKTKDGYVEVSGKHEEKQQEGGIVSKNFT     71 - 140
KKIQLPAEVDPVTVFASLSPEGLLIIEAPQVPPYSTFGESSFNNELPQDSQEVTCT                  141 - 196
//

Text Mined References (95)

PMID Year Title