Property Summary

NCBI Gene PubMed Count 28
PubMed Score 1.78
PubTator Score 0.97

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (3)

Disease log2 FC p
ependymoma 1.500 0.002
oligodendroglioma 1.300 0.002
glioblastoma 1.100 0.000

Synonym

Accession Q9UJX6 Q5VSG1 Q96DG5 Q96GG4 Q9P2E1 APC2
Symbols APC2

Gene

PANTHER Protein Class (2)

PDB

4UI9   5A31   5G04   5G05   5KHR   5L9U   5LCW   4YII  

Gene RIF (9)

PMID Text
24804778 The regulation of Mdm2 by the E3 ubiquitin ligase APC/C is shown. It has important therapeutic implications for tumors with Mdm2 overexpression.
22190034 HIV-1 PR is identified to have a physical interaction with anaphase promoting complex subunit 2 (ANAPC2) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
22190034 HIV-1 PR is identified to have a physical interaction with anaphase promoting complex subunit 2 (ANAPC2) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
21903591 anaphase-promoting complex (APC)-2-cell cycle and apoptosis regulatory protein (CARP)-1 interaction antagonists are novel regulators of cell growth and apoptosis
21768287 It proposes a role for APC/C(Cdh1) in modulating the status of PCNA monoubiquitination and UV DNA repair before S phase entry.
18976975 Knockdown of anaphase promoting complex subunit 2 (ANAPC2) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
18854154 Knockdown of anaphase promoting complex subunit 2 (ANAPC2) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
16364912 Results describe the locations of Cdh1 and Apc2 in the anaphase-promoting complex/cyclosome of human and Xenopus laevis.
11739784 APC2 Cullin protein and APC11 RING protein comprise the minimal ubiquitin ligase module of the anaphase-promoting complex.

AA Sequence

MAAAVVVAEGDSDSRPGQELLVAWNTVSTGLVPPAALGLVSSRTSGAVPPKEEELRAAVEVLRGHGLHSV      1 - 70
LEEWFVEVLQNDLQANISPEFWNAISQCENSADEPQCLLLLLDAFGLLESRLDPYLRSLELLEKWTRLGL     71 - 140
LMGTGAQGLREEVHTMLRGVLFFSTPRTFQEMIQRLYGCFLRVYMQSKRKGEGGTDPELEGELDSRYARR    141 - 210
RYYRLLQSPLCAGCSSDKQQCWCRQALEQFHQLSQVLHRLSLLERVSAEAVTTTLHQVTRERMEDRCRGE    211 - 280
YERSFLREFHKWIERVVGWLGKVFLQDGPARPASPEAGNTLRRWRCHVQRFFYRIYASLRIEELFSIVRD    281 - 350
FPDSRPAIEDLKYCLERTDQRQQLLVSLKAALETRLLHPGVNTCDIITLYISAIKALRVLDPSMVILEVA    351 - 420
CEPIRRYLRTREDTVRQIVAGLTGDSDGTGDLAVELSKTDPASLETGQDSEDDSGEPEDWVPDPVDADPG    421 - 490
KSSSKRRSSDIISLLVSIYGSKDLFINEYRSLLADRLLHQFSFSPEREIRNVELLKLRFGEAPMHFCEVM    491 - 560
LKDMADSRRINANIREEDEKRPAEEQPPFGVYAVILSSEFWPPFKDEKLEVPEDIRAALEAYCKKYEQLK    561 - 630
AMRTLSWKHTLGLVTMDVELADRTLSVAVTPVQAVILLYFQDQASWTLEELSKAVKMPVALLRRRMSVWL    631 - 700
QQGVLREEPPGTFSVIEEERPQDRDNMVLIDSDDESDSGMASQADQKEEELLLFWTYIQAMLTNLESLSL    701 - 770
DRIYNMLRMFVVTGPALAEIDLQELQGYLQKKVRDQQLVYSAGVYRLPKNCS                      771 - 822
//

Publication (37)

PMID Year Title
25043029 2014 Molecular architecture and mechanism of the anaphase-promoting complex.
24804778 2014 The anaphase-promoting complex/cyclosome is an E3 ubiquitin ligase for Mdm2.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21903591 2011 Antagonists of anaphase-promoting complex (APC)-2-cell cycle and apoptosis regulatory protein (CARP)-1 interaction are novel regulators of cell growth and apoptosis.
21768287 2011 APC/CCdh1-dependent proteolysis of USP1 regulates the response to UV-mediated DNA damage.
21269460 2011 Initial characterization of the human central proteome.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
More...