Property Summary

NCBI Gene PubMed Count 28
PubMed Score 0.13
PubTator Score 13.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -1.771 0.000
intraductal papillary-mucinous adenoma (... 1.200 0.004
ovarian cancer -2.400 0.000

Synonym

Accession Q9UJX5 A8K8H1 E9PCR4 Q6PCC6 Q9NSH6 APC4
Symbols APC4

Gene

PDB

4UI9   5A31   5G04   5G05   5KHR   5BPW  

Gene RIF (2)

PMID Text
20686030 Inactivation and disassembly of the anaphase-promoting complex during human cytomegalovirus infection is associated with degradation of the APC5 and APC4 subunits and does not require UL97-mediated phosphorylation of Cdh1.
19826416 Studies indicate that APC/C(Cdh1) is required to maintain genomic stability.

AA Sequence

MLRFPTCFPSFRVVGEKQLPQEIIFLVWSPKRDLIALANTAGEVLLHRLASFHRVWSFPPNENTGKEVTC      1 - 70
LAWRPDGKLLAFALADTKKIVLCDVEKPESLHSFSVEAPVSCMHWMEVTVESSVLTSFYNAEDESNLLLP     71 - 140
KLPTLPKNYSNTSKIFSEENSDEIIKLLGDVRLNILVLGGSSGFIELYAYGMFKIARVTGIAGTCLALCL    141 - 210
SSDLKSLSVVTEVSTNGASEVSYFQLETNLLYSFLPEVTRMARKFTHISALLQYINLSLTCMCEAWEEIL    211 - 280
MQMDSRLTKFVQEKNTTTSVQDEFMHLLLWGKASAELQTLLMNQLTVKGLKKLGQSIESSYSSIQKLVIS    281 - 350
HLQSGSESLLYHLSELKGMASWKQKYEPLGLDAAGIEEAITAVGSFILKANELLQVIDSSMKNFKAFFRW    351 - 420
LYVAMLRMTEDHVLPELNKMTQKDITFVAEFLTEHFNEAPDLYNRKGKYFNVERVGQYLKDEDDDLVSPP    421 - 490
NTEGNQWYDFLQNSSHLKESPLLFPYYPRKSLHFVKRRMENIIDQCLQKPADVIGKSMNQAICIPLYRDT    491 - 560
RSEDSTRRLFKFPFLWNNKTSNLHYLLFTILEDSLYKMCILRRHTDISQSVSNGLIAIKFGSFTYATTEK    561 - 630
VRRSIYSCLDAQFYDDETVTVVLKDTVGREGRDRLLVQLPLSLVYNSEDSAEYQFTGTYSTRLDEQCSAI    631 - 700
PTRTMHFEKHWRLLESMKAQYVAGNGFRKVSCVLSSNLRHVRVFEMDIDDEWELDESSDEEEEASNKPVK    701 - 770
IKEEVLSESEAENQQAGAAALAPEIVIKVEKLDPELDS                                    771 - 808
//

Text Mined References (36)

PMID Year Title
25043029 2014 Molecular architecture and mechanism of the anaphase-promoting complex.
23288039 2013 Mechanisms controlling the temporal degradation of Nek2A and Kif18A by the APC/C-Cdc20 complex.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21926987 2011 APC15 drives the turnover of MCC-CDC20 to make the spindle assembly checkpoint responsive to kinetochore attachment.
21241890 2011 Nuclear PTEN regulates the APC-CDH1 tumor-suppressive complex in a phosphatase-independent manner.
20966902 2011 Genome-wide association study of anthropometric traits and evidence of interactions with age and study year in Filipino women.
20686030 2010 Inactivation and disassembly of the anaphase-promoting complex during human cytomegalovirus infection is associated with degradation of the APC5 and APC4 subunits and does not require UL97-mediated phosphorylation of Cdh1.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19826416 2010 The emerging role of APC/CCdh1 in controlling differentiation, genomic stability and tumor suppression.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
More...