Property Summary

NCBI Gene PubMed Count 30
PubMed Score 28.68
PubTator Score 13.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
acute quadriplegic myopathy 1.321 4.8e-06
adrenocortical carcinoma 1.583 7.1e-06
astrocytic glioma 1.600 8.0e-03
atypical teratoid / rhabdoid tumor 1.300 2.6e-04
diabetes mellitus 2.500 1.3e-03
ependymoma 1.200 2.6e-02
Gaucher disease type 1 -1.500 2.5e-02
glioblastoma 1.500 1.2e-03
group 4 medulloblastoma 1.300 4.4e-03
interstitial lung disease 1.300 3.0e-03
juvenile dermatomyositis 1.360 2.6e-11
lung adenocarcinoma 1.100 2.0e-03
lung cancer 1.200 3.4e-04
lung carcinoma 1.800 3.6e-10
medulloblastoma, large-cell 2.100 6.8e-05
mucosa-associated lymphoid tissue lympho... -1.153 5.5e-03
non diabetic and post-ischemic heart fai... 1.300 1.4e-02
non primary Sjogren syndrome sicca -1.500 1.1e-02
non-small cell lung carcinoma 1.100 4.7e-12
oligodendroglioma 1.200 2.8e-03
osteosarcoma 3.852 1.9e-07
ovarian cancer -1.600 9.6e-09
pancreatic ductal adenocarcinoma liver m... 1.507 4.0e-03
Pick disease -1.200 5.5e-05
psoriasis 1.200 6.2e-05

 GO Function (1)

Gene RIF (4)

AA Sequence

MASVHESLYFNPMMTNGVVHANVFGIKDWVTPYKIAVLVLLNEMSRTGEGAVSLMERRRLNQLLLPLLQG      1 - 70
PDITLSKLYKLIEESCPQLANSVQIRIKLMAEGELKDMEQFFDDLSDSFSGTEPEVHKTSVVGLFLRHMI     71 - 140
LAYSKLSFSQVFKLYTALQQYFQNGEKKTVEDADMELTSRDEGERKMEKEELDVSVREEEVSCSGPLSQK    141 - 210
QAEFFLSQQASLLKNDETKALTPASLQKELNNLLKFNPDFAEAHYLSYLNNLRVQDVFSSTHSLLHYFDR    211 - 280
LILTGAESKSNGEEGYGRSLRYAALNLAALHCRFGHYQQAELALQEAIRIAQESNDHVCLQHCLSWLYVL    281 - 350
GQKRSDSYVLLEHSVKKAVHFGLPYLASLGIQSLVQQRAFAGKTANKLMDALKDSDLLHWKHSLSELIDI    351 - 420
SIAQKTAIWRLYGRSTMALQQAQMLLSMNSLEAVNAGVQQNNTESFAVALCHLAELHAEQGCFAAASEVL    421 - 490
KHLKERFPPNSQHAQLWMLCDQKIQFDRAMNDGKYHLADSLVTGITALNSIEGVYRKAVVLQAQNQMSEA    491 - 560
HKLLQKLLVHCQKLKNTEMVISVLLSVAELYWRSSSPTIALPMLLQALALSKEYRLQYLASETVLNLAFA    561 - 630
QLILGIPEQALSLLHMAIEPILADGAILDKGRAMFLVAKCQVASAASYDQPKKAEALEAAIENLNEAKNY    631 - 700
FAKVDCKERIRDVVYFQARLYHTLGKTQERNRCAMLFRQLHQELPSHGVPLINHL                   701 - 755
//

Text Mined References (38)

PMID Year Title