Property Summary

NCBI Gene PubMed Count 30
Grant Count 6
Funding $397,773.2
PubMed Score 27.17
PubTator Score 13.99

Knowledge Summary

Patent

No data available

Expression

 GO Function (1)

Gene RIF (4)

PMID Text
20686030 Inactivation and disassembly of the anaphase-promoting complex during human cytomegalovirus infection is associated with degradation of the APC5 and APC4 subunits and does not require UL97-mediated phosphorylation of Cdh1.
19826416 Studies indicate that APC/C(Cdh1) is required to maintain genomic stability.
16319895 APC5 and APC7 suppress E1A-mediated transformation in a CBP/p300-dependent manner, indicating that these components of the APC/C may be targeted during cellular transformation
15082755 Results show that Apc5 binds the poly(A) binding protein (PABP), which directly binds the internal ribosome entry site (IRES) element of platelet-derived growth factor 2 mRNA.

AA Sequence

MASVHESLYFNPMMTNGVVHANVFGIKDWVTPYKIAVLVLLNEMSRTGEGAVSLMERRRLNQLLLPLLQG      1 - 70
PDITLSKLYKLIEESCPQLANSVQIRIKLMAEGELKDMEQFFDDLSDSFSGTEPEVHKTSVVGLFLRHMI     71 - 140
LAYSKLSFSQVFKLYTALQQYFQNGEKKTVEDADMELTSRDEGERKMEKEELDVSVREEEVSCSGPLSQK    141 - 210
QAEFFLSQQASLLKNDETKALTPASLQKELNNLLKFNPDFAEAHYLSYLNNLRVQDVFSSTHSLLHYFDR    211 - 280
LILTGAESKSNGEEGYGRSLRYAALNLAALHCRFGHYQQAELALQEAIRIAQESNDHVCLQHCLSWLYVL    281 - 350
GQKRSDSYVLLEHSVKKAVHFGLPYLASLGIQSLVQQRAFAGKTANKLMDALKDSDLLHWKHSLSELIDI    351 - 420
SIAQKTAIWRLYGRSTMALQQAQMLLSMNSLEAVNAGVQQNNTESFAVALCHLAELHAEQGCFAAASEVL    421 - 490
KHLKERFPPNSQHAQLWMLCDQKIQFDRAMNDGKYHLADSLVTGITALNSIEGVYRKAVVLQAQNQMSEA    491 - 560
HKLLQKLLVHCQKLKNTEMVISVLLSVAELYWRSSSPTIALPMLLQALALSKEYRLQYLASETVLNLAFA    561 - 630
QLILGIPEQALSLLHMAIEPILADGAILDKGRAMFLVAKCQVASAASYDQPKKAEALEAAIENLNEAKNY    631 - 700
FAKVDCKERIRDVVYFQARLYHTLGKTQERNRCAMLFRQLHQELPSHGVPLINHL                   701 - 755
//

Text Mined References (38)

PMID Year Title
25043029 2014 Molecular architecture and mechanism of the anaphase-promoting complex.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21307936 2011 Structural basis for the subunit assembly of the anaphase-promoting complex.
21269460 2011 Initial characterization of the human central proteome.
21241890 2011 Nuclear PTEN regulates the APC-CDH1 tumor-suppressive complex in a phosphatase-independent manner.
20686030 2010 Inactivation and disassembly of the anaphase-promoting complex during human cytomegalovirus infection is associated with degradation of the APC5 and APC4 subunits and does not require UL97-mediated phosphorylation of Cdh1.
19826416 2010 The emerging role of APC/CCdh1 in controlling differentiation, genomic stability and tumor suppression.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18485873 2008 Mechanism of ubiquitin-chain formation by the human anaphase-promoting complex.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
More...