Property Summary

NCBI Gene PubMed Count 30
PubMed Score 27.17
PubTator Score 13.99

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
juvenile dermatomyositis 1189 2.55426453467285E-11
ovarian cancer 8492 1.31000654113605E-8
non-small cell lung carcinoma 413 1.13359294937065E-7
osteosarcoma 7933 1.87393773185267E-7
lung carcinoma 2844 2.75221084822714E-7
acute quadriplegic myopathy 1157 4.83617746341387E-6
adrenocortical carcinoma 1427 7.08105673185485E-6
Pick disease 1893 3.36088251561853E-5
psoriasis 6685 6.17071700115571E-5
medulloblastoma, large-cell 6234 6.83966809636899E-5
lung cancer 4473 1.37219982309482E-4
atypical teratoid / rhabdoid tumor 4369 2.63573079337887E-4
glioblastoma 5572 0.00123873071224251
diabetes mellitus 1663 0.00130398373926687
lung adenocarcinoma 2714 0.00195691897479697
interstitial lung disease 292 0.00297316378067709
medulloblastoma 1524 0.00372377812749547
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00401630903085904
oligodendroglioma 2849 0.00574700335965812
mucosa-associated lymphoid tissue lymphoma 480 0.00780803017411744
astrocytic glioma 2241 0.00797793962681614
non primary Sjogren syndrome sicca 840 0.0113957544581129
non diabetic and post-ischemic heart failure 200 0.0140398115458232
Gaucher disease type 1 171 0.0253898503682897
ependymoma 2514 0.0262407350340983

Expression

Synonym

Accession Q9UJX4 E9PFB2 Q8N4H7 Q9BQD4 APC5
Symbols APC5

Gene

PDB

4UI9   5A31   5G04   5G05   5KHR   5L9U   5LCW  

  Ortholog (9)

 GO Function (1)

Gene RIF (4)

PMID Text
20686030 Inactivation and disassembly of the anaphase-promoting complex during human cytomegalovirus infection is associated with degradation of the APC5 and APC4 subunits and does not require UL97-mediated phosphorylation of Cdh1.
19826416 Studies indicate that APC/C(Cdh1) is required to maintain genomic stability.
16319895 APC5 and APC7 suppress E1A-mediated transformation in a CBP/p300-dependent manner, indicating that these components of the APC/C may be targeted during cellular transformation
15082755 Results show that Apc5 binds the poly(A) binding protein (PABP), which directly binds the internal ribosome entry site (IRES) element of platelet-derived growth factor 2 mRNA.

AA Sequence

MASVHESLYFNPMMTNGVVHANVFGIKDWVTPYKIAVLVLLNEMSRTGEGAVSLMERRRLNQLLLPLLQG      1 - 70
PDITLSKLYKLIEESCPQLANSVQIRIKLMAEGELKDMEQFFDDLSDSFSGTEPEVHKTSVVGLFLRHMI     71 - 140
LAYSKLSFSQVFKLYTALQQYFQNGEKKTVEDADMELTSRDEGERKMEKEELDVSVREEEVSCSGPLSQK    141 - 210
QAEFFLSQQASLLKNDETKALTPASLQKELNNLLKFNPDFAEAHYLSYLNNLRVQDVFSSTHSLLHYFDR    211 - 280
LILTGAESKSNGEEGYGRSLRYAALNLAALHCRFGHYQQAELALQEAIRIAQESNDHVCLQHCLSWLYVL    281 - 350
GQKRSDSYVLLEHSVKKAVHFGLPYLASLGIQSLVQQRAFAGKTANKLMDALKDSDLLHWKHSLSELIDI    351 - 420
SIAQKTAIWRLYGRSTMALQQAQMLLSMNSLEAVNAGVQQNNTESFAVALCHLAELHAEQGCFAAASEVL    421 - 490
KHLKERFPPNSQHAQLWMLCDQKIQFDRAMNDGKYHLADSLVTGITALNSIEGVYRKAVVLQAQNQMSEA    491 - 560
HKLLQKLLVHCQKLKNTEMVISVLLSVAELYWRSSSPTIALPMLLQALALSKEYRLQYLASETVLNLAFA    561 - 630
QLILGIPEQALSLLHMAIEPILADGAILDKGRAMFLVAKCQVASAASYDQPKKAEALEAAIENLNEAKNY    631 - 700
FAKVDCKERIRDVVYFQARLYHTLGKTQERNRCAMLFRQLHQELPSHGVPLINHL                   701 - 755
//

Text Mined References (38)

PMID Year Title
25043029 2014 Molecular architecture and mechanism of the anaphase-promoting complex.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21307936 2011 Structural basis for the subunit assembly of the anaphase-promoting complex.
21269460 2011 Initial characterization of the human central proteome.
21241890 2011 Nuclear PTEN regulates the APC-CDH1 tumor-suppressive complex in a phosphatase-independent manner.
20686030 2010 Inactivation and disassembly of the anaphase-promoting complex during human cytomegalovirus infection is associated with degradation of the APC5 and APC4 subunits and does not require UL97-mediated phosphorylation of Cdh1.
19826416 2010 The emerging role of APC/CCdh1 in controlling differentiation, genomic stability and tumor suppression.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18485873 2008 Mechanism of ubiquitin-chain formation by the human anaphase-promoting complex.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
More...