Property Summary

NCBI Gene PubMed Count 34
PubMed Score 1.26
PubTator Score 9.57

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -1.184 0.000
intraductal papillary-mucinous neoplasm ... 1.200 0.002
Pick disease -1.300 0.000

Synonym

Accession Q9UJX3 Q96AC4 Q96GF4 Q9BU24 Q9NT16 APC7
Symbols APC7

Gene

PDB

4UI9   5A31   5G04   5G05   5KHR   5L9U   5LCW   3FFL  

 GO Function (1)

Gene RIF (7)

PMID Text
26046517 The results showed that APC2 and APC7 subunits were both over expressed in cancer cell lines
23078409 Data indicate that additional density present in the anaphase-promoting complex (APC/C) structure, proximal to Apc3/Cdc27 of the (tetratricopeptide repeat) lobe, is assigned to the TPR subunit Apc7, a subunit specific to vertebrate APC/C.
19826416 Studies indicate that APC/C(Cdh1) is required to maintain genomic stability.
19091741 The crystal structure of quad mutant of nApc7 (N-terminal fragment, residues 1-147) of human Apc7 at a resolution of 2.5 A, is reported.
18789487 Expression of ANAPC7 in fibroadenomas and phylloides tumors of breast is reported.
16319895 APC5 and APC7 suppress E1A-mediated transformation in a CBP/p300-dependent manner, indicating that these components of the APC/C may be targeted during cellular transformation
15743504 dysregulation of APC activity, possibly through downregulation of APC7, may be associated with tumorigenesis in breast cancer

AA Sequence

MDPGDAAILESSLRILYRLFESVLPPLPAALQSRMNVIDHVRDMAAAGLHSNVRLLSSLLLTMSNNNPEL      1 - 70
FSPPQKYQLLVYHADSLFHDKEYRNAVSKYTMALQQKKALSKTSKVRPSTGNSASTPQSQCLPSEIEVKY     71 - 140
KMAECYTMLKQDKDAIAILDGIPSRQRTPKINMMLANLYKKAGQERPSVTSYKEVLRQCPLALDAILGLL    141 - 210
SLSVKGAEVASMTMNVIQTVPNLDWLSVWIKAYAFVHTGDNSRAISTICSLEKKSLLRDNVDLLGSLADL    211 - 280
YFRAGDNKNSVLKFEQAQMLDPYLIKGMDVYGYLLAREGRLEDVENLGCRLFNISDQHAEPWVVSGCHSF    281 - 350
YSKRYSRALYLGAKAIQLNSNSVQALLLKGAALRNMGRVQEAIIHFREAIRLAPCRLDCYEGLIECYLAS    351 - 420
NSIREAMVMANNVYKTLGANAQTLTLLATVCLEDPVTQEKAKTLLDKALTQRPDYIKAVVKKAELLSREQ    421 - 490
KYEDGIALLRNALANQSDCVLHRILGDFLVAVNEYQEAMDQYSIALSLDPNDQKSLEGMQKMEKEESPTD    491 - 560
ATQEEDVDDMEGSGEEGDLEGSDSEAAQWADQEQWFGMQ                                   561 - 599
//

Text Mined References (40)

PMID Year Title
26046517 2015 The expression pattern of APC2 and APC7 in various cancer cell lines and AML patients.
25043029 2014 Molecular architecture and mechanism of the anaphase-promoting complex.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23078409 2013 Recombinant expression, reconstitution and structure of human anaphase-promoting complex (APC/C).
21926987 2011 APC15 drives the turnover of MCC-CDC20 to make the spindle assembly checkpoint responsive to kinetochore attachment.
21269460 2011 Initial characterization of the human central proteome.
21241890 2011 Nuclear PTEN regulates the APC-CDH1 tumor-suppressive complex in a phosphatase-independent manner.
19826416 2010 The emerging role of APC/CCdh1 in controlling differentiation, genomic stability and tumor suppression.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19091741 2009 Crystal structure of the N-terminal domain of anaphase-promoting complex subunit 7.
More...