Property Summary

NCBI Gene PubMed Count 37
Grant Count 4
R01 Count 4
Funding $417,757.84
PubMed Score 30.42
PubTator Score 12.22

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9UJX2 A8K6E5 B4E3A2 B7WP05 D3DQB7 O75433 Q53FN2 Q9BS73
Symbols APC8
CUT23
ANAPC8

Gene

PDB

4UI9   5A31   5G04   5G05   5KHR   5L9U   5LCW  

Gene RIF (4)

PMID Text
25064703 Results identified CDC23 as a miR-34c-regulated target that could be responsible for the miR-34c-induced cell cycle arrest.
21990323 CDC23 is a critical regulator of cell cycle and cell growth, may be involved in thyroid cancer initiation and progression, and may explain the different tumor biology observed by gender.
21336306 Cdc20 requires APC3 and APC8 to bind and activate the APC/C when the spindle assembly checkpoint is satisfied, but only APC8 when active, and APC10 is crucial for the destruction of cyclin B1 and securin, but not cyclin A
12629511 We report gene alterations in several components of this complex in human colon cancer cells, including APC6/CDC16 and APC8/CDC23 which are known to be key function elements.

AA Sequence

MAASTSMVPVAVTAAVAPVLSINSDFSDLREIKKQLLLIAGLTRERGLLHSSKWSAELAFSLPALPLAEL      1 - 70
QPPPPITEEDAQDMDAYTLAKAYFDVKEYDRAAHFLHGCNSKKAYFLYMYSRYLSGEKKKDDETVDSLGP     71 - 140
LEKGQVKNEALRELRVELSKKHQARELDGFGLYLYGVVLRKLDLVKEAIDVFVEATHVLPLHWGAWLELC    141 - 210
NLITDKEMLKFLSLPDTWMKEFFLAHIYTELQLIEEALQKYQNLIDVGFSKSSYIVSQIAVAYHNIRDID    211 - 280
KALSIFNELRKQDPYRIENMDTFSNLLYVRSMKSELSYLAHNLCEIDKYRVETCCVIGNYYSLRSQHEKA    281 - 350
ALYFQRALKLNPRYLGAWTLMGHEYMEMKNTSAAIQAYRHAIEVNKRDYRAWYGLGQTYEILKMPFYCLY    351 - 420
YYRRAHQLRPNDSRMLVALGECYEKLNQLVEAKKCYWRAYAVGDVEKMALVKLAKLHEQLTESEQAAQCY    421 - 490
IKYIQDIYSCGEIVEHLEESTAFRYLAQYYFKCKLWDEASTCAQKCCAFNDTREEGKALLRQILQLRNQG    491 - 560
ETPTTEVPAPFFLPASLSANNTPTRRVSPLNLSSVTP                                     561 - 597
//

Text Mined References (52)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25416956 2014 A proteome-scale map of the human interactome network.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25064703 2014 Expression of miR-34c induces G2/M cell cycle arrest in breast cancer cells.
25043029 2014 Molecular architecture and mechanism of the anaphase-promoting complex.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21990323 2011 CDC23 regulates cancer cell phenotype and is overexpressed in papillary thyroid cancer.
21926987 2011 APC15 drives the turnover of MCC-CDC20 to make the spindle assembly checkpoint responsive to kinetochore attachment.
More...