Property Summary

NCBI Gene PubMed Count 20
PubMed Score 13.51
PubTator Score 19.61

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.200 0.000
medulloblastoma -1.100 0.000
medulloblastoma, large-cell -1.200 0.000
primitive neuroectodermal tumor -1.100 0.000
diabetes mellitus 1.400 0.001

Gene RIF (9)

PMID Text
24786516 miR-320a has a role in modulating the induction of HO-1, GCLM and OKL38 by oxidized phospholipids in endothelial cells
24417816 Identify OSGIN1 as a tumor suppressor that is down-regulated or altered in human hepatocellular carcinoma.
22912861 Data suggest that OKL38 regulates mitochondria morphology and functions during apoptosis together with p53.
20198315 Observational study of gene-disease association. (HuGE Navigator)
19851296 Observational study of gene-disease association. (HuGE Navigator)
18499678 identify OKL38 as a novel p53 target gene that is regulated by Peptidylarginine deiminase 4 and plays a role in apoptosis
16924236 The 5'UTRs of OKL38 might play an important role in downregulation of its protein and the absence of OKL38 could lead to the development or progression of hepatocellular carcinoma.
15569677 BDGI (Bone marrow stromal cell-derived growth inhibitor) inhibits growth and migration of breast cancer cells via induction of cell cycle arrest and apoptosis [BDGI]
14570898 Expression in cultured tumor cells resulted in growth inhibition and cell death.

AA Sequence

MGKWRPRGCCRGNMQCRQEVPATLTSSELFSTRNQPQPQPQPLLADAPVPWAVASRMCLTPGQGCGHQGQ      1 - 70
DEGPLPAPSPPPAMSSSRKDHLGASSSEPLPVIIVGNGPSGICLSYLLSGYTPYTKPDAIHPHPLLQRKL     71 - 140
TEAPGVSILDQDLDYLSEGLEGRSQSPVALLFDALLRPDTDFGGNMKSVLTWKHRKEHAIPHVVLGRNLP    141 - 210
GGAWHSIEGSMVILSQGQWMGLPDLEVKDWMQKKRRGLRNSRATAGDIAHYYRDYVVKKGLGHNFVSGAV    211 - 280
VTAVEWGTPDPSSCGAQDSSPLFQVSGFLTRNQAQQPFSLWARNVVLATGTFDSPARLGIPGEALPFIHH    281 - 350
ELSALEAATRVGAVTPASDPVLIIGAGLSAADAVLYARHYNIPVIHAFRRAVDDPGLVFNQLPKMLYPEY    351 - 420
HKVHQMMREQSILSPSPYEGYRSLPRHQLLCFKEDCQAVFQDLEGVEKVFGVSLVLVLIGSHPDLSFLPG    421 - 490
AGADFAVDPDQPLSAKRNPIDVDPFTYQSTRQEGLYAMGPLAGDNFVRFVQGGALAVASSLLRKETRKPP    491 - 560
//

Text Mined References (23)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24786516 2014 MicroRNA miR-320a modulates induction of HO-1, GCLM and OKL38 by oxidized phospholipids in endothelial cells.
24417816 2014 Allele-specific imbalance of oxidative stress-induced growth inhibitor 1 associates with progression of hepatocellular carcinoma.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22912861 2012 Interaction of OKL38 and p53 in regulating mitochondrial structure and function.
21737788 2011 Network for activation of human endothelial cells by oxidized phospholipids: a critical role of heme oxygenase 1.
20307321 2010 Ultrafine particles from diesel vehicle emissions at different driving cycles induce differential vascular pro-inflammatory responses: implication of chemical components and NF-kappaB signaling.
20198315 2010 Association of genetic variants with hemorrhagic stroke in Japanese individuals.
19851296 2010 Assessment of a polymorphism of SDK1 with hypertension in Japanese Individuals.
19578798 2009 Growth inhibition of estrogen receptor positive human breast cancer cells by Taheebo from the inner bark of Tabebuia avellandae tree.
More...