Property Summary

NCBI Gene PubMed Count 9
PubMed Score 23.65
PubTator Score 4.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Synonym

Accession Q9UJW9 B3KQB3 Q96CQ2
Symbols RBT1

Gene

Gene RIF (1)

PMID Text
17260023 Transduction of stably expressed human SERTAD3 induces cell transformation in vitro and tumor formation in mice via a transcription factor E2F-dependent mechanism.

AA Sequence

MVGGLKRKHSDLEEEEERWEWSPAGLQSYQQALLRISLDKVQRSLGPRAPSLRRHVLIHNTLQQLQAALR      1 - 70
LAPAPALPPEPLFLGEEDFSLSATIGSILRELDTSMDGTEPPQNPVTPLGLQNEVPPQPDPVFLEALSSR     71 - 140
YLGDSGLDDFFLDIDTSAVEKEPARAPPEPPHNLFCAPGSWEWNELDHIMEIILGS                  141 - 196
//

Text Mined References (10)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
19060904 2009 An empirical framework for binary interactome mapping.
17260023 2007 Overexpression of SERTAD3, a putative oncogene located within the 19q13 amplicon, induces E2F activity and promotes tumor growth.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16098148 2005 SEI family of nuclear factors regulates p53-dependent transcriptional activation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11331592 2001 TRIP-Br: a novel family of PHD zinc finger- and bromodomain-interacting proteins that regulate the transcriptional activity of E2F-1/DP-1.
10982866 2000 RBT1, a novel transcriptional co-activator, binds the second subunit of replication protein A.