Property Summary

NCBI Gene PubMed Count 41
Grant Count 17
R01 Count 11
Funding $1,876,840.45
PubMed Score 83.55
PubTator Score 58.05

Knowledge Summary

Patent

No data available

Expression

Gene RIF (29)

PMID Text
26647998 the present study has demonstrated that variations in the DNMT3L gene do not contribute to stage I-II endometriosis-associated infertility.
25383530 crystal structures of DNMT3A-DNMT3L (autoinhibitory form) and DNMT3A-DNMT3L-H3 (active form) complexes at 3.82 and 2.90 A resolution, respectively
24952347 DNMT3L can address DNMT3A/B to specific sites by directly interacting with TFs that do not directly interact with DNMT3A/B
24859147 DNMT3L rs2070565 (genotype P = 0.007, allele P = 0.0026) confers an increased risk of developing schizophrenia at an early age in individuals with family history.
24743422 CpG island encompassing the promoter and first exon of human DNMT3L gene is a PcG/TrX response element
22671959 DNMT3L is one of the key players in de novo DNA methylation of imprinting control elements and retrotransposons, which occurs after genome-wide epigenetic erasure during germ cell development. (Review)
22401780 Genetic polymorphisms of DNMT3L involved in hypermethylation of chromosomal ends are associated with greater risk of developing ovarian endometriosis.
22116073 SNP rs2070565, as well as haplotypes AAA and GAA, may be associated with male infertility; DNMT3L may contribute to azoospermia susceptibility in humans
21126912 mutation analysis of SYCP3, DNMT3L and MSH4 in patients with maturation arrest of spermatogenesis and couples with recurrent miscarriages.
20838592 This study offers insights into the manner by which DNA methylation patterns are deposited and reveals a new level of interplay between members of the de novo DNMT family.
More...

AA Sequence

MAAIPALDPEAEPSMDVILVGSSELSSSVSPGTGRDLIAYEVKANQRNIEDICICCGSLQVHTQHPLFEG      1 - 70
GICAPCKDKFLDALFLYDDDGYQSYCSICCSGETLLICGNPDCTRCYCFECVDSLVGPGTSGKVHAMSNW     71 - 140
VCYLCLPSSRSGLLQRRRKWRSQLKAFYDRESENPLEMFETVPVWRRQPVRVLSLFEDIKKELTSLGFLE    141 - 210
SGSDPGQLKHVVDVTDTVRKDVEEWGPFDLVYGATPPLGHTCDRPPSWYLFQFHRLLQYARPKPGSPRPF    211 - 280
FWMFVDNLVLNKEDLDVASRFLEMEPVTIPDVHGGSLQNAVRVWSNIPAIRSRHWALVSEEELSLLAQNK    281 - 350
QSSKLAAKWPTKLVKNCFLPLREYFKYFSTELTSSL                                      351 - 386
//

Text Mined References (41)

PMID Year Title
26647998 2016 Association between DNMT3L polymorphic variants and the risk of endometriosis-associated infertility.
25416956 2014 A proteome-scale map of the human interactome network.
25383530 2015 Structural insight into autoinhibition and histone H3-induced activation of DNMT3A.
24952347 2014 DNMT3L interacts with transcription factors to target DNMT3L/DNMT3B to specific DNA sequences: role of the DNMT3L/DNMT3B/p65-NF?B complex in the (de-)methylation of TRAF1.
24859147 2014 DNA methyl transferase (DNMT) gene polymorphisms could be a primary event in epigenetic susceptibility to schizophrenia.
24743422 2014 The CpG island encompassing the promoter and first exon of human DNMT3L gene is a PcG/TrX response element (PRE).
22671959 2012 Functions of DNA methyltransferase 3-like in germ cells and beyond.
22401780 2012 Genetic polymorphisms of DNMT3L involved in hypermethylation of chromosomal ends are associated with greater risk of developing ovarian endometriosis.
22116073 2012 Association between single-nucleotide polymorphisms of DNMT3L and infertility with azoospermia in Chinese men.
21126912 2011 Mutation analysis of three genes in patients with maturation arrest of spermatogenesis and couples with recurrent miscarriages.
More...