Property Summary

NCBI Gene PubMed Count 42
PubMed Score 87.17
PubTator Score 58.05

Knowledge Summary

Patent

No data available

Expression

Gene RIF (30)

AA Sequence

MAAIPALDPEAEPSMDVILVGSSELSSSVSPGTGRDLIAYEVKANQRNIEDICICCGSLQVHTQHPLFEG      1 - 70
GICAPCKDKFLDALFLYDDDGYQSYCSICCSGETLLICGNPDCTRCYCFECVDSLVGPGTSGKVHAMSNW     71 - 140
VCYLCLPSSRSGLLQRRRKWRSQLKAFYDRESENPLEMFETVPVWRRQPVRVLSLFEDIKKELTSLGFLE    141 - 210
SGSDPGQLKHVVDVTDTVRKDVEEWGPFDLVYGATPPLGHTCDRPPSWYLFQFHRLLQYARPKPGSPRPF    211 - 280
FWMFVDNLVLNKEDLDVASRFLEMEPVTIPDVHGGSLQNAVRVWSNIPAIRSRHWALVSEEELSLLAQNK    281 - 350
QSSKLAAKWPTKLVKNCFLPLREYFKYFSTELTSSL                                      351 - 386
//

Text Mined References (42)

PMID Year Title