Property Summary

NCBI Gene PubMed Count 12
Grant Count 9
R01 Count 5
Funding $1,647,996.5
PubMed Score 26.86
PubTator Score 18.50

Knowledge Summary

Patent

No data available

Expression

Gene RIF (2)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20157734 An hTIN-ag defect may be a potent cause of end-stage renal failure in childhood.

AA Sequence

MWTGYKILIFSYLTTEIWMEKQYLSQREVDLEAYFTRNHTVLQGTRFKRAIFQGQYCRNFGCCEDRDDGC      1 - 70
VTEFYAANALCYCDKFCDRENSDCCPDYKSFCREEKEWPPHTQPWYPEGCFKDGQHYEEGSVIKENCNSC     71 - 140
TCSGQQWKCSQHVCLVRSELIEQVNKGDYGWTAQNYSQFWGMTLEDGFKFRLGTLPPSPMLLSMNEMTAS    141 - 210
LPATTDLPEFFVASYKWPGWTHGPLDQKNCAASWAFSTASVAADRIAIQSKGRYTANLSPQNLISCCAKN    211 - 280
RHGCNSGSIDRAWWYLRKRGLVSHACYPLFKDQNATNNGCAMASRSDGRGKRHATKPCPNNVEKSNRIYQ    281 - 350
CSPPYRVSSNETEIMKEIMQNGPVQAIMQVREDFFHYKTGIYRHVTSTNKESEKYRKLQTHAVKLTGWGT    351 - 420
LRGAQGQKEKFWIAANSWGKSWGENGYFRILRGVNESDIEKLIIAAWGQLTSSDEP                  421 - 476
//

Text Mined References (14)

PMID Year Title
20923822 2010 Radiation pharmacogenomics: a genome-wide association approach to identify radiation response biomarkers using human lymphoblastoid cell lines.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20157734 2010 A tubulointerstitial nephritis antigen gene defect causes childhood-onset chronic renal failure.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10752525 2000 Identification of two alternatively spliced forms of human tubulointerstitial nephritis antigen (TIN-Ag).
10652240 2000 Molecular cloning, expression, and chromosomal localization of a human tubulointerstitial nephritis antigen.
9643646 1998 Tubulointerstitial nephritis antigen (TIN-ag) is expressed in distinct segments of the developing human nephron.
More...