Property Summary

NCBI Gene PubMed Count 12
PubMed Score 27.83
PubTator Score 18.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Diabetic Nephropathies 37 0.0 0.0
Kidney Diseases 114 0.0 0.0
Disease Target Count
Diabetic Nephropathy 34
Disease Target Count P-value
ulcerative colitis 1819 1.5e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Melanoma 711 0.0 0.6
Skin cancer 469 0.0 0.5
Disease Target Count Z-score Confidence
Nephronophthisis 80 4.028 2.0
Kidney disease 430 3.284 1.6

Expression

  Differential Expression (1)

Disease log2 FC p
ulcerative colitis -1.700 1.5e-04

Gene RIF (2)

AA Sequence

MWTGYKILIFSYLTTEIWMEKQYLSQREVDLEAYFTRNHTVLQGTRFKRAIFQGQYCRNFGCCEDRDDGC      1 - 70
VTEFYAANALCYCDKFCDRENSDCCPDYKSFCREEKEWPPHTQPWYPEGCFKDGQHYEEGSVIKENCNSC     71 - 140
TCSGQQWKCSQHVCLVRSELIEQVNKGDYGWTAQNYSQFWGMTLEDGFKFRLGTLPPSPMLLSMNEMTAS    141 - 210
LPATTDLPEFFVASYKWPGWTHGPLDQKNCAASWAFSTASVAADRIAIQSKGRYTANLSPQNLISCCAKN    211 - 280
RHGCNSGSIDRAWWYLRKRGLVSHACYPLFKDQNATNNGCAMASRSDGRGKRHATKPCPNNVEKSNRIYQ    281 - 350
CSPPYRVSSNETEIMKEIMQNGPVQAIMQVREDFFHYKTGIYRHVTSTNKESEKYRKLQTHAVKLTGWGT    351 - 420
LRGAQGQKEKFWIAANSWGKSWGENGYFRILRGVNESDIEKLIIAAWGQLTSSDEP                  421 - 476
//

Text Mined References (14)

PMID Year Title