Property Summary

NCBI Gene PubMed Count 12
PubMed Score 26.86
PubTator Score 18.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Diabetic Nephropathy 37
Kidney Diseases 86
Disease Target Count P-value
ulcerative colitis 2087 1.52998039884198E-4
Disease Target Count Z-score Confidence
Nephronophthisis 74 4.03 2.0
Kidney disease 397 3.359 1.7

Expression

Synonym

Accession Q9UJW2 Q5T467 Q9UJW1 Q9ULZ4 TIN-Ag
Symbols TIN-AG

Gene

PANTHER Protein Class (3)

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA Inparanoid
C. elegans EggNOG Inparanoid

Gene RIF (2)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20157734 An hTIN-ag defect may be a potent cause of end-stage renal failure in childhood.

AA Sequence

MWTGYKILIFSYLTTEIWMEKQYLSQREVDLEAYFTRNHTVLQGTRFKRAIFQGQYCRNFGCCEDRDDGC      1 - 70
VTEFYAANALCYCDKFCDRENSDCCPDYKSFCREEKEWPPHTQPWYPEGCFKDGQHYEEGSVIKENCNSC     71 - 140
TCSGQQWKCSQHVCLVRSELIEQVNKGDYGWTAQNYSQFWGMTLEDGFKFRLGTLPPSPMLLSMNEMTAS    141 - 210
LPATTDLPEFFVASYKWPGWTHGPLDQKNCAASWAFSTASVAADRIAIQSKGRYTANLSPQNLISCCAKN    211 - 280
RHGCNSGSIDRAWWYLRKRGLVSHACYPLFKDQNATNNGCAMASRSDGRGKRHATKPCPNNVEKSNRIYQ    281 - 350
CSPPYRVSSNETEIMKEIMQNGPVQAIMQVREDFFHYKTGIYRHVTSTNKESEKYRKLQTHAVKLTGWGT    351 - 420
LRGAQGQKEKFWIAANSWGKSWGENGYFRILRGVNESDIEKLIIAAWGQLTSSDEP                  421 - 476
//

Text Mined References (14)

PMID Year Title
20923822 2010 Radiation pharmacogenomics: a genome-wide association approach to identify radiation response biomarkers using human lymphoblastoid cell lines.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20157734 2010 A tubulointerstitial nephritis antigen gene defect causes childhood-onset chronic renal failure.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10752525 2000 Identification of two alternatively spliced forms of human tubulointerstitial nephritis antigen (TIN-Ag).
10652240 2000 Molecular cloning, expression, and chromosomal localization of a human tubulointerstitial nephritis antigen.
9643646 1998 Tubulointerstitial nephritis antigen (TIN-ag) is expressed in distinct segments of the developing human nephron.
More...