Property Summary

NCBI Gene PubMed Count 13
PubMed Score 7.19
PubTator Score 16.13

Knowledge Summary


No data available


  Differential Expression (7)

Disease log2 FC p
malignant mesothelioma 1.200 0.000
oligodendroglioma 1.300 0.039
osteosarcoma 1.427 0.000
group 4 medulloblastoma 1.900 0.000
glioblastoma 1.100 0.014
tuberculosis and treatment for 6 months 1.100 0.001
ovarian cancer -1.900 0.000


Accession Q9UJW0 B3KWW0 D3DQH0 E5RGT5 Q8TAN8 Dyn4
Symbols P62


Gene RIF (2)

22772370 used an extreme phenotype study to discover that variants in DCTN4, encoding a dynactin protein, are associated with time to first P. aeruginosa airway infection, chronic P. aeruginosa infection and mucoid P. aeruginosa in individuals with cystic fibrosis
16554302 ATP7B interaction with p62 is a key component of the copper-induced trafficking pathway that delivers ATP7B to subapical vesicles of hepatocytes for the removal of excess copper into bile

AA Sequence

MKHDFKNLAAPIRPIEESDQGTEVIWLTQHVELSLGPLLP                                  421 - 460

Publication (19)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
25416956 2014 A proteome-scale map of the human interactome network.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22772370 2012 Exome sequencing of extreme phenotypes identifies DCTN4 as a modifier of chronic Pseudomonas aeruginosa infection in cystic fibrosis.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21399614 2011 Novel asymmetrically localizing components of human centrosomes identified by complementary proteomics methods.
21269460 2011 Initial characterization of the human central proteome.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.