Property Summary

NCBI Gene PubMed Count 16
PubMed Score 7.19
PubTator Score 16.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
glioblastoma 1.100 1.4e-02
group 3 medulloblastoma 1.400 2.6e-02
malignant mesothelioma 1.200 3.2e-06
oligodendroglioma 1.300 3.9e-02
osteosarcoma 1.427 4.0e-05
ovarian cancer -1.900 1.1e-05
tuberculosis and treatment for 6 months 1.100 9.3e-04

 GO Function (1)

Protein-protein Interaction (2)

Gene RIF (3)

AA Sequence

MASLLQSDRVLYLVQGEKKVRAPLSQLYFCRYCSELRSLECVSHEVDSHYCPSCLENMPSAEAKLKKNRC      1 - 70
ANCFDCPGCMHTLSTRATSISTQLPDDPAKTTMKKAYYLACGFCRWTSRDVGMADKSVASGGWQEPENPH     71 - 140
TQRMNKLIEYYQQLAQKEKVERDRKKLARRRNYMPLAFSDKYGLGTRLQRPRAGASISTLAGLSLKEGED    141 - 210
QKEIKIEPAQAVDEVEPLPEDYYTRPVNLTEVTTLQQRLLQPDFQPVCASQLYPRHKHLLIKRSLRCRKC    211 - 280
EHNLSKPEFNPTSIKFKIQLVAVNYIPEVRIMSIPNLRYMKESQVLLTLTNPVENLTHVTLFECEEGDPD    281 - 350
DINSTAKVVVPPKELVLAGKDAAAEYDELAEPQDFQDDPDIIAFRKANKVGIFIKVTPQREEGEVTVCFK    351 - 420
MKHDFKNLAAPIRPIEESDQGTEVIWLTQHVELSLGPLLP                                  421 - 460
//

Text Mined References (23)

PMID Year Title