Property Summary

NCBI Gene PubMed Count 29
PubMed Score 3929.96
PubTator Score 15.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (5)

Disease log2 FC p
lung cancer 1.200 2.6e-03
Multiple myeloma 1.274 6.6e-05
non primary Sjogren syndrome sicca 1.100 4.3e-02
ovarian cancer 2.900 8.3e-07
Waldenstrons macroglobulinemia 1.150 3.9e-03

 MGI Phenotype (1)

Protein-protein Interaction (9)

Gene RIF (11)

AA Sequence

MEESEPERKRARTDEVPAGGSRSEAEDEDDEDYVPYVPLRQRRQLLLQKLLQRRRKGAAEEEQQDSGSEP      1 - 70
RGDEDDIPLGPQSNVSLLDQHQHLKEKAEARKESAKEKQLKEEEKILESVAEGRALMSVKEMAKGITYDD     71 - 140
PIKTSWTPPRYVLSMSEERHERVRKKYHILVEGDGIPPPIKSFKEMKFPAAILRGLKKKGIHHPTPIQIQ    141 - 210
GIPTILSGRDMIGIAFTGSGKTLVFTLPVIMFCLEQEKRLPFSKREGPYGLIICPSRELARQTHGILEYY    211 - 280
CRLLQEDSSPLLRCALCIGGMSVKEQMETIRHGVHMMVATPGRLMDLLQKKMVSLDICRYLALDEADRMI    281 - 350
DMGFEGDIRTIFSYFKGQRQTLLFSATMPKKIQNFAKSALVKPVTINVGRAGAASLDVIQEVEYVKEEAK    351 - 420
MVYLLECLQKTPPPVLIFAEKKADVDAIHEYLLLKGVEAVAIHGGKDQEERTKAIEAFREGKKDVLVATD    421 - 490
VASKGLDFPAIQHVINYDMPEEIENYVHRIGRTGRSGNTGIATTFINKACDESVLMDLKALLLEAKQKVP    491 - 560
PVLQVLHCGDESMLDIGGERGCAFCGGLGHRITDCPKLEAMQTKQVSNIGRKDYLAHSSMDF            561 - 622
//

Text Mined References (40)

PMID Year Title