Property Summary

NCBI Gene PubMed Count 4
Grant Count 2
Funding $72,883.5
PubMed Score 8.03
PubTator Score 2.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.100 0.015
glioblastoma -1.400 0.014
medulloblastoma, large-cell -1.800 0.000
pediatric high grade glioma -1.200 0.005

Gene RIF (2)

PMID Text
23333304 HIV-1 Vif modulates the expression of purine-rich element binding protein G (PURG) in Vif-expression T cells
12034829 Distinct proteins encoded by alternative transcripts of the PURG gene, located contrapodal to WRN on chromosome 8, determined by differential termination/polyadenylation

AA Sequence

MERARRRGGGGGRGRGGKNVGGSGLSKSRLYPQAQHSHYPHYAASATPNQAGGAAEIQELASKRVDIQKK      1 - 70
RFYLDVKQSSRGRFLKIAEVWIGRGRQDNIRKSKLTLSLSVAAELKDCLGDFIEHYAHLGLKGHRQEHGH     71 - 140
SKEQGSRRRQKHSAPSPPVSVGSEEHPHSVLKTDYIERDNRKYYLDLKENQRGRFLRIRQTMMRGTGMIG    141 - 210
YFGHSLGQEQTIVLPAQGMIEFRDALVQLIEDYGEGDIEERRGGDDDPLELPEGTSFRVDNKRFYFDVGS    211 - 280
NKYGIFLKVSEVRPPYRNTITVPFKAWTRFGENFIKYEEEMRKICNSHKEKRMDGRKASGEEQECLD       281 - 347
//

Publication (5)

PMID Year Title
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12034829 2002 Distinct proteins encoded by alternative transcripts of the PURG gene, located contrapodal to WRN on chromosome 8, determined by differential termination/polyadenylation.