Property Summary

NCBI Gene PubMed Count 4
PubMed Score 8.03
PubTator Score 2.13

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
medulloblastoma, large-cell 6234 1.82325549269643E-5
pediatric high grade glioma 2712 0.00522280609421974
glioblastoma 5572 0.013643088588153
atypical teratoid / rhabdoid tumor 4369 0.0147496980502032
Disease Target Count Z-score Confidence
Werner syndrome 29 3.749 1.9

Expression

  Differential Expression (4)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.100 0.015
glioblastoma -1.400 0.014
medulloblastoma, large-cell -1.800 0.000
pediatric high grade glioma -1.200 0.005

Synonym

Accession Q9UJV8 Q8TE64
Symbols PURG-A
PURG-B

Gene

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG
Opossum OMA EggNOG Inparanoid
Anole lizard OMA Inparanoid

Gene RIF (2)

PMID Text
23333304 HIV-1 Vif modulates the expression of purine-rich element binding protein G (PURG) in Vif-expression T cells
12034829 Distinct proteins encoded by alternative transcripts of the PURG gene, located contrapodal to WRN on chromosome 8, determined by differential termination/polyadenylation

AA Sequence

MERARRRGGGGGRGRGGKNVGGSGLSKSRLYPQAQHSHYPHYAASATPNQAGGAAEIQELASKRVDIQKK      1 - 70
RFYLDVKQSSRGRFLKIAEVWIGRGRQDNIRKSKLTLSLSVAAELKDCLGDFIEHYAHLGLKGHRQEHGH     71 - 140
SKEQGSRRRQKHSAPSPPVSVGSEEHPHSVLKTDYIERDNRKYYLDLKENQRGRFLRIRQTMMRGTGMIG    141 - 210
YFGHSLGQEQTIVLPAQGMIEFRDALVQLIEDYGEGDIEERRGGDDDPLELPEGTSFRVDNKRFYFDVGS    211 - 280
NKYGIFLKVSEVRPPYRNTITVPFKAWTRFGENFIKYEEEMRKICNSHKEKRMDGRKASGEEQECLD       281 - 347
//

Text Mined References (5)

PMID Year Title
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12034829 2002 Distinct proteins encoded by alternative transcripts of the PURG gene, located contrapodal to WRN on chromosome 8, determined by differential termination/polyadenylation.