Property Summary

NCBI Gene PubMed Count 20
Grant Count 57
R01 Count 20
Funding $18,447,474.28
PubMed Score 299.33
PubTator Score 24.83

Knowledge Summary


No data available


  Differential Expression (4)

Disease log2 FC p
psoriasis 1.200 0.001
intraductal papillary-mucinous carcinoma... -1.100 0.001
intraductal papillary-mucinous neoplasm ... -1.300 0.005
lung cancer -1.300 0.005

Gene RIF (4)

26748699 Mid2 regulates cell division through the ubiquitination of astrin on K409, which is critical for its degradation and proper cytokinesis.
24115387 A novel missense mutation (c.1040G>A, p.Arg347Gln) was reported in MID2, which encodes ubiquitin ligase E3, as the likely cause of X-linked mental retardation in a large kindred.
16283679 MID2 is a candidate gene for FG syndrome.
11806752 MID2 coiled-coil motifs mediate both homo- and heterodimerization, a prerequisite for association of the MID-alpha 4 complex with microtubules.

AA Sequence

LSGLPAPDFIDYPERQECNCRPQESPYVSGMKTCH                                       701 - 735

Text Mined References (20)

PMID Year Title
26748699 2016 The X-Linked-Intellectual-Disability-Associated Ubiquitin Ligase Mid2 Interacts with Astrin and Regulates Astrin Levels to Promote Cell Division.
26347139 2015 TRIM-mediated precision autophagy targets cytoplasmic regulators of innate immunity.
25416956 2014 A proteome-scale map of the human interactome network.
24115387 2014 Targeted deep resequencing identifies MID2 mutation for X-linked intellectual disability with varied disease severity in a large kindred from India.
23077300 2013 TRIM protein-mediated regulation of inflammatory and innate immune signaling and its association with antiretroviral activity.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18248090 2008 TRIM E3 ligases interfere with early and late stages of the retroviral life cycle.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16283679 2005 An Xq22.3 duplication detected by comparative genomic hybridization microarray (Array-CGH) defines a new locus (FGS5) for FG syndrome.