Property Summary

NCBI Gene PubMed Count 20
PubMed Score 299.33
PubTator Score 24.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
psoriasis 6685 7.7662324639691E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00149788611934667
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00499031355585645
lung cancer 4473 0.00502168751436145
Disease Target Count Z-score Confidence
Intellectual disability 573 0.0 4.0
Disease Target Count
Mental retardation, X-linked 101 1

Expression

  Differential Expression (4)

Disease log2 FC p
psoriasis 1.200 0.001
intraductal papillary-mucinous carcinoma... -1.100 0.001
intraductal papillary-mucinous neoplasm ... -1.300 0.005
lung cancer -1.300 0.005

Synonym

Accession Q9UJV3 A6NEL8 A6PVI5 Q5JYF5 Q8WWK1 Q9UJR9
Symbols FXY2
RNF60
TRIM1
MRX101

Gene

PDB

2DJA   2DMK  

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Horse OMA EggNOG Inparanoid
Pig OMA Inparanoid
Opossum OMA Inparanoid
Chicken OMA Inparanoid

Gene RIF (4)

PMID Text
26748699 Mid2 regulates cell division through the ubiquitination of astrin on K409, which is critical for its degradation and proper cytokinesis.
24115387 A novel missense mutation (c.1040G>A, p.Arg347Gln) was reported in MID2, which encodes ubiquitin ligase E3, as the likely cause of X-linked mental retardation in a large kindred.
16283679 MID2 is a candidate gene for FG syndrome.
11806752 MID2 coiled-coil motifs mediate both homo- and heterodimerization, a prerequisite for association of the MID-alpha 4 complex with microtubules.

AA Sequence

MGESPASVVLNASGGLFSLKMETLESELTCPICLELFEDPLLLPCAHSLCFSCAHRILVSSCSSGESIEP      1 - 70
ITAFQCPTCRYVISLNHRGLDGLKRNVTLQNIIDRFQKASVSGPNSPSESRRERTYRPTTAMSSERIACQ     71 - 140
FCEQDPPRDAVKTCITCEVSYCDRCLRATHPNKKPFTSHRLVEPVPDTHLRGITCLDHENEKVNMYCVSD    141 - 210
DQLICALCKLVGRHRDHQVASLNDRFEKLKQTLEMNLTNLVKRNSELENQMAKLIQICQQVEVNTAMHEA    211 - 280
KLMEECDELVEIIQQRKQMIAVKIKETKVMKLRKLAQQVANCRQCLERSTVLINQAEHILKENDQARFLQ    281 - 350
SAKNIAERVAMATASSQVLIPDINFNDAFENFALDFSREKKLLEGLDYLTAPNPPSIREELCTASHDTIT    351 - 420
VHWISDDEFSISSYELQYTIFTGQANFISKSWCSWGLWPEIRKCKEAVSCSRLAGAPRGLYNSVDSWMIV    421 - 490
PNIKQNHYTVHGLQSGTRYIFIVKAINQAGSRNSEPTRLKTNSQPFKLDPKMTHKKLKISNDGLQMEKDE    491 - 560
SSLKKSHTPERFSGTGCYGAAGNIFIDSGCHYWEVVMGSSTWYAIGIAYKSAPKNEWIGKNASSWVFSRC    561 - 630
NSNFVVRHNNKEMLVDVPPHLKRLGVLLDYDNNMLSFYDPANSLHLHTFDVTFILPVCPTFTIWNKSLMI    631 - 700
LSGLPAPDFIDYPERQECNCRPQESPYVSGMKTCH                                       701 - 735
//

Text Mined References (20)

PMID Year Title
26748699 2016 The X-Linked-Intellectual-Disability-Associated Ubiquitin Ligase Mid2 Interacts with Astrin and Regulates Astrin Levels to Promote Cell Division.
26347139 2015 TRIM-mediated precision autophagy targets cytoplasmic regulators of innate immunity.
25416956 2014 A proteome-scale map of the human interactome network.
24115387 2014 Targeted deep resequencing identifies MID2 mutation for X-linked intellectual disability with varied disease severity in a large kindred from India.
23077300 2013 TRIM protein-mediated regulation of inflammatory and innate immune signaling and its association with antiretroviral activity.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18248090 2008 TRIM E3 ligases interfere with early and late stages of the retroviral life cycle.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16283679 2005 An Xq22.3 duplication detected by comparative genomic hybridization microarray (Array-CGH) defines a new locus (FGS5) for FG syndrome.
More...