Property Summary

NCBI Gene PubMed Count 21
PubMed Score 303.42
PubTator Score 24.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
intraductal papillary-mucinous carcinoma... -1.100 1.5e-03
intraductal papillary-mucinous neoplasm ... -1.300 5.0e-03
lung cancer -1.300 5.0e-03
psoriasis 1.200 7.8e-04

Gene RIF (5)

AA Sequence

MGESPASVVLNASGGLFSLKMETLESELTCPICLELFEDPLLLPCAHSLCFSCAHRILVSSCSSGESIEP      1 - 70
ITAFQCPTCRYVISLNHRGLDGLKRNVTLQNIIDRFQKASVSGPNSPSESRRERTYRPTTAMSSERIACQ     71 - 140
FCEQDPPRDAVKTCITCEVSYCDRCLRATHPNKKPFTSHRLVEPVPDTHLRGITCLDHENEKVNMYCVSD    141 - 210
DQLICALCKLVGRHRDHQVASLNDRFEKLKQTLEMNLTNLVKRNSELENQMAKLIQICQQVEVNTAMHEA    211 - 280
KLMEECDELVEIIQQRKQMIAVKIKETKVMKLRKLAQQVANCRQCLERSTVLINQAEHILKENDQARFLQ    281 - 350
SAKNIAERVAMATASSQVLIPDINFNDAFENFALDFSREKKLLEGLDYLTAPNPPSIREELCTASHDTIT    351 - 420
VHWISDDEFSISSYELQYTIFTGQANFISKSWCSWGLWPEIRKCKEAVSCSRLAGAPRGLYNSVDSWMIV    421 - 490
PNIKQNHYTVHGLQSGTRYIFIVKAINQAGSRNSEPTRLKTNSQPFKLDPKMTHKKLKISNDGLQMEKDE    491 - 560
SSLKKSHTPERFSGTGCYGAAGNIFIDSGCHYWEVVMGSSTWYAIGIAYKSAPKNEWIGKNASSWVFSRC    561 - 630
NSNFVVRHNNKEMLVDVPPHLKRLGVLLDYDNNMLSFYDPANSLHLHTFDVTFILPVCPTFTIWNKSLMI    631 - 700
LSGLPAPDFIDYPERQECNCRPQESPYVSGMKTCH                                       701 - 735
//

Text Mined References (21)

PMID Year Title