Property Summary

NCBI Gene PubMed Count 39
Grant Count 4
R01 Count 4
Funding $335,767.34
PubMed Score 20.70
PubTator Score 24.42

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (3)

Disease log2 FC p
primary pancreatic ductal adenocarcinoma 1.007 0.013
diabetes mellitus -1.200 0.008
pancreatic cancer 1.100 0.005

Protein-protein Interaction (7)

Gene RIF (13)

PMID Text
25715176 The results presented here indicate that targeting IL-1alpha with subcutaneous MABp1 adminisration has a strong potential therapeutic value in treating psoriasis and may provide a novel future treatment of this often devastating disease.
25690657 Data suggest that by binding to both clathrin and F-actin, mammalian actin-binding protein 1 (mAbp1; HIP-55 or SH3P7) is specifically recruited at a late stage of clathrin-coated pits (CCPs) formation, which subsequently recruits dynamin to CCPs.
24912570 HIP-55 expression promoted proliferation, colony formation, migration, and invasion of lung cancer cells and was upregulated in lung cancer cell lines and tumor tissues of lung cancer patients
24668193 Data suggest that HIP-55 could play an important role in the growth and cellular proliferation and HIP-55 dysfunction could be involved in tumorigenesis.
24651461 Data indicate that fourteen phosphorylation sites along the primary structure of hematopoietic progenitor kinase 1 (HPK1)-interacting protein of 55 kDa (HIP-55) rotein were identified.
22450813 mAbp1 is of fundamental importance for spreading and migration under shear stress conditions, which are critical prerequisites for efficient PMN extravasation during inflammation.
18829961 Filamentous actin (F-actin)-binding protein 1 (Abp1/SH3P7/HIP-55) has a profound impact on synaptic organization by making a required functional connection between postsynaptic density components and postsynaptic actin dynamics.
17306257 unexpected role of 3BP2 in endocytic and cytoskeletal regulation through its interaction with CIN85 and HIP-55
16055701 HIP-55 has roles in T-cell proliferation, cytokine production, and immune responses
14729663 HIP-55 is a key novel component of the immunological synapse that modulates T cell activation by connecting actin cytoskeleton and TCRs to gene activation and endocytic processes
More...

AA Sequence

MAANLSRNGPALQEAYVRVVTEKSPTDWALFTYEGNSNDIRVAGTGEGGLEEMVEELNSGKVMYAFCRVK      1 - 70
DPNSGLPKFVLINWTGEGVNDVRKGACASHVSTMASFLKGAHVTINARAEEDVEPECIMEKVAKASGANY     71 - 140
SFHKESGRFQDVGPQAPVGSVYQKTNAVSEIKRVGKDSFWAKAEKEEENRRLEEKRRAEEAQRQLEQERR    141 - 210
ERELREAARREQRYQEQGGEASPQRTWEQQQEVVSRNRNEQESAVHPREIFKQKERAMSTTSISSPQPGK    211 - 280
LRSPFLQKQLTQPETHFGREPAAAISRPRADLPAEEPAPSTPPCLVQAEEEAVYEEPPEQETFYEQPPLV    281 - 350
QQQGAGSEHIDHHIQGQGLSGQGLCARALYDYQAADDTEISFDPENLITGIEVIDEGWWRGYGPDGHFGM    351 - 420
FPANYVELIE                                                                421 - 430
//

Publication (51)

PMID Year Title
25715176 2015 Open-Label Trial of MABp1, a True Human Monoclonal Antibody Targeting Interleukin 1?, for the Treatment of Psoriasis.
25690657 2015 Mammalian actin-binding protein 1/HIP-55 is essential for the scission of clathrin-coated pits by regulating dynamin-actin interaction.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25416956 2014 A proteome-scale map of the human interactome network.
24912570 2014 Pro-oncogenic function of HIP-55/Drebrin-like (DBNL) through Ser269/Thr291-phospho-sensor motifs.
24816252 2014 An atlas of genetic influences on human blood metabolites.
24668193 2014 Regulation of cell survival by the HIP-55 signaling network.
24651461 2014 Phosphosite mapping of HIP-55 protein in mammalian cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...