Property Summary

NCBI Gene PubMed Count 40
PubMed Score 21.06
PubTator Score 24.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count
Bipolar Disorder 666
Disease Target Count P-value
pancreatic cancer 2398 4.6e-03
diabetes mellitus 1728 7.7e-03
primary pancreatic ductal adenocarcinoma 1109 1.3e-02
Disease Target Count Z-score Confidence
Hereditary spherocytosis type 1 23 3.64 1.8

Expression

  Differential Expression (3)

Disease log2 FC p
diabetes mellitus -1.200 7.7e-03
pancreatic cancer 1.100 4.6e-03
primary pancreatic ductal adenocarcinoma 1.007 1.3e-02

Protein-protein Interaction (6)

Gene RIF (14)

AA Sequence

MAANLSRNGPALQEAYVRVVTEKSPTDWALFTYEGNSNDIRVAGTGEGGLEEMVEELNSGKVMYAFCRVK      1 - 70
DPNSGLPKFVLINWTGEGVNDVRKGACASHVSTMASFLKGAHVTINARAEEDVEPECIMEKVAKASGANY     71 - 140
SFHKESGRFQDVGPQAPVGSVYQKTNAVSEIKRVGKDSFWAKAEKEEENRRLEEKRRAEEAQRQLEQERR    141 - 210
ERELREAARREQRYQEQGGEASPQRTWEQQQEVVSRNRNEQESAVHPREIFKQKERAMSTTSISSPQPGK    211 - 280
LRSPFLQKQLTQPETHFGREPAAAISRPRADLPAEEPAPSTPPCLVQAEEEAVYEEPPEQETFYEQPPLV    281 - 350
QQQGAGSEHIDHHIQGQGLSGQGLCARALYDYQAADDTEISFDPENLITGIEVIDEGWWRGYGPDGHFGM    351 - 420
FPANYVELIE                                                                421 - 430
//

Text Mined References (52)

PMID Year Title