Property Summary

NCBI Gene PubMed Count 30
PubMed Score 482.71
PubTator Score 62.57

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
AUTOIMMUNE DISEASE, SUSCEPTIBILITY TO, 1 1 0.0 0.0
Disease Target Count P-value
psoriasis 6694 8.8e-18
Astrocytoma, Pilocytic 3081 2.2e-02
Disease Target Count Z-score Confidence
Vascular disease 319 0.0 1.5
Disease Target Count Z-score Confidence
Vitiligo 73 3.463 1.7
Entropion 22 3.45 1.7
Vestibular nystagmus 6 3.413 1.7
Cancer 2499 3.081 1.5

Expression

  Differential Expression (2)

Disease log2 FC p
Astrocytoma, Pilocytic 1.300 2.2e-02
psoriasis -1.200 8.8e-18

Gene RIF (25)

AA Sequence

MTLSGGGSASDMSGQTVLTAEDVDIDVVGEGDDGLEEKDSDAGCDSPAGPPELRLDEADEVPPAAPHHGQ      1 - 70
PQPPHQQPLTLPKEAAGAGAGPGGDVGAPEADGCKGGVGGEEGGASGGGPGAGSGSAGGLAPSKPKNSLV     71 - 140
KPPYSYIALITMAILQSPQKKLTLSGICEFISNRFPYYREKFPAWQNSIRHNLSLNDCFVKIPREPGNPG    141 - 210
KGNYWTLDPQSEDMFDNGSFLRRRKRFKRHQQEHLREQTALMMQSFGAYSLAAAAGAAGPYGRPYGLHPA    211 - 280
AAAGAYSHPAAAAAAAAAAALQYPYALPPVAPVLPPAVPLLPSGELGRKAAAFGSQLGPGLQLQLNSLGA    281 - 350
AAAAAGTAGAAGTTASLIKSEPSARPSFSIENIIGGGPAAPGGSAVGAGVAGGTGGSGGGSTAQSFLRPP    351 - 420
GTVQSAALMATHQPLSLSRTTATIAPILSVPLSGQFLQPAASAAAAAAAAAQAKWPAQ                421 - 478
//

Text Mined References (30)

PMID Year Title