Property Summary

NCBI Gene PubMed Count 26
Grant Count 161
R01 Count 93
Funding $31,931,807.39
PubMed Score 456.18
PubTator Score 62.57

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
pilocytic astrocytoma 1.200 0.026
psoriasis -1.200 0.000

Synonym

Accession Q9UJU5 Q9BYM2 Q9UDD1
Symbols AIS1
HFH2
VAMAS2
Genesis

Gene

Gene RIF (21)

PMID Text
26898989 The present study finds that the aspirin-FOXD3-OLA1P2-STAT3 axis exhibits exciting anticancer effects and provides new insights into the chemopreventive mechanisms underlying aspirin use
26341266 FOXD3 overexpression significantly inhibits cell growth and results in G1 cell cycle arrest in NSCLC A549 and H1299 cells.
26267147 In addition to a possible association of rs78645479 in FoxD3 with vitiligo, our data on the association of this FoxD3 variant with thyroid autoantibodies suggest a potential involvement of FoxD3 in thyroid immunoregulation.
26252164 FOXD3 is sufficient but not necessary to drive PAX3 expression in melanoma cells.
26205821 Data show that transcription factors PAX3 and FOXD3-mediated melanoma cell migration is dependent on promoting the expression of chemokine receptor CXCR4.
26112097 Down-regulation of FOXD3 is associated with metastasis in hepatocellular carcinoma.
26011451 FOXD3 might serve as an independent prognostic biomarker and a potential therapeutic target for high-grade gliomas, which warrant further investigation.
25061102 FOXD3 and TWIST1 define distinct subgroups of cells within a heterogeneous tumor.
24970808 Findings indicate that miR-137 is a valuable biomarker for hepatocellular carcinoma (HCC) prognosis and the forkhead box D3 (FoxD3)/miR-137/AKT2 regulatory network plays an important role in HCC progression.
24632201 Our results indicate FOXD3 exhibits tumor suppressive activity and may be useful for breast therapy.
More...

AA Sequence

MTLSGGGSASDMSGQTVLTAEDVDIDVVGEGDDGLEEKDSDAGCDSPAGPPELRLDEADEVPPAAPHHGQ      1 - 70
PQPPHQQPLTLPKEAAGAGAGPGGDVGAPEADGCKGGVGGEEGGASGGGPGAGSGSAGGLAPSKPKNSLV     71 - 140
KPPYSYIALITMAILQSPQKKLTLSGICEFISNRFPYYREKFPAWQNSIRHNLSLNDCFVKIPREPGNPG    141 - 210
KGNYWTLDPQSEDMFDNGSFLRRRKRFKRHQQEHLREQTALMMQSFGAYSLAAAAGAAGPYGRPYGLHPA    211 - 280
AAAGAYSHPAAAAAAAAAAALQYPYALPPVAPVLPPAVPLLPSGELGRKAAAFGSQLGPGLQLQLNSLGA    281 - 350
AAAAAGTAGAAGTTASLIKSEPSARPSFSIENIIGGGPAAPGGSAVGAGVAGGTGGSGGGSTAQSFLRPP    351 - 420
GTVQSAALMATHQPLSLSRTTATIAPILSVPLSGQFLQPAASAAAAAAAAAQAKWPAQ                421 - 478
//

Publication (26)

PMID Year Title
26898989 2016 The aspirin-induced long non-coding RNA OLA1P2 blocks phosphorylated STAT3 homodimer formation.
26341266 2015 FOXD3 suppresses tumor growth and angiogenesis in non-small cell lung cancer.
26267147 2015 A novel FoxD3 Variant Is Associated With Vitiligo and Elevated Thyroid Auto-Antibodies.
26252164 2016 FOXD3 Promotes PAX3 Expression in Melanoma Cells.
26205821 2015 PAX3 and FOXD3 Promote CXCR4 Expression in Melanoma.
26112097 2015 Hypermethylation of FOXD3 suppresses cell proliferation, invasion and metastasis in hepatocellular carcinoma.
26011451 2015 Decreased FOXD3 Expression Is Associated with Poor Prognosis in Patients with High-Grade Gliomas.
25061102 2014 FOXD3 modulates migration through direct transcriptional repression of TWIST1 in melanoma.
24970808 2014 FoxD3-regulated microRNA-137 suppresses tumour growth and metastasis in human hepatocellular carcinoma by targeting AKT2.
24632201 2014 FoxD3 deficiency promotes breast cancer progression by induction of epithelial-mesenchymal transition.
More...