Property Summary

NCBI Gene PubMed Count 166
Grant Count 362
R01 Count 230
Funding $30,374,172.86
PubMed Score 352.41
PubTator Score 279.56

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9UJU2 B4DG38 B7Z8E2 E9PDK3 Q3ZCU4 Q9HAZ0 LEF-1
Symbols LEF-1
TCF10
TCF7L3
TCF1ALPHA

Gene

PANTHER Protein Class (1)

Gene RIF (115)

PMID Text
27067790 The results suggest a role for beta-catenin/LEF1-mediated transcription in both malignant transformation and metastasis of prostate cancer
26580798 LEF-1 and MITF regulate tyrosinase gene transcription in vitro via binding to its promoter.
26339357 Methylprednisolone can suppress Wnt signaling pathway by down-regulating LEF-1 protein expression in chronic lymphocyte leukemia cells.
25955539 Overexpression of LEF1 is a favorable prognostic factor in childhood ALL.
25942645 high LEF1 expression and mutation are associated with high-risk leukemia and our results also revealed that LEF1 high expression and/or gain-of-function mutations are involved in leukemogenesis of ALL.
25808920 Authors found that the N-terminus of delta-catenin bound to the middle region of LEF-1 unlike beta-catenin. Overexpressed delta-catenin entered the nucleus and inhibited LEF-1-mediated transcriptional activity in Bosc23 and DLD-1 cell lines.
25646419 study identified TCF1 and LEF1 as Tax antagonistic factors in vivo, a fact which may critically influence the peripheral T-cell tropism of this virus
25639559 The results describe a novel mutation in LEF1 causing dysregulation of Wnt/B catenin signaling in eyelid sebaceous cancinoma
25596247 Proper sample processing ensured sufficient separation of positive LEF1 staining in T cells from negative staining in normal B and natural killer (NK) cells
25587085 Study found a negative correlation between miR-34a and LEF1 expression in prostate cancer cell lines and tumors and that miR-34a regulated epithelial-mesenchymal transition through direct binding to LEF1 mRNA 3' UTR region and silencing its translation.
More...

AA Sequence

MPQLSGGGGGGGGDPELCATDEMIPFKDEGDPQKEKIFAEISHPEEEGDLADIKSSLVNESEIIPASNGH      1 - 70
EVARQAQTSQEPYHDKAREHPDDGKHPDGGLYNKGPSYSSYSGYIMMPNMNNDPYMSNGSLSPPIPRTSN     71 - 140
KVPVVQPSHAVHPLTPLITYSDEHFSPGSHPSHIPSDVNSKQGMSRHPPAPDIPTFYPLSPGGVGQITPP    141 - 210
LGWQGQPVYPITGGFRQPYPSSLSVDTSMSRFSHHMIPGPPGPHTTGIPHPAIVTPQVKQEHPHTDSDLM    211 - 280
HVKPQHEQRKEQEPKRPHIKKPLNAFMLYMKEMRANVVAECTLKESAAINQILGRRWHALSREEQAKYYE    281 - 350
LARKERQLHMQLYPGWSARDNYGKKKKRKREKLQESASGTGPRMTAAYI                         351 - 399
//

Text Mined References (170)

PMID Year Title
27067790 2016 Expression and colocalization of ?-catenin and lymphoid enhancing factor-1 in prostate cancer progression.
26580798 2015 LEF-1 Regulates Tyrosinase Gene Transcription In Vitro.
26339357 2015 Methylprednisolone suppresses the Wnt signaling pathway in chronic lymphocytic leukemia cell line MEC-1 regulated by LEF-1 expression.
25955539 2015 Overexpression of lymphoid enhancer-binding factor-1 (LEF1) is a novel favorable prognostic factor in childhood acute lymphoblastic leukemia.
25942645 2015 Characterization of LEF1 High Expression and Novel Mutations in Adult Acute Lymphoblastic Leukemia.
25808920 2015 ?-Catenin interacts with LEF-1 and negatively regulates its transcriptional activity.
25646419 2015 TCF1 and LEF1 act as T-cell intrinsic HTLV-1 antagonists by targeting Tax.
25639559 2015 Eyelid sebaceous carcinoma: a novel mutation in lymphoid enhancer-binding factor-1.
25596247 2015 Flow cytometric analysis of lymphoid enhancer-binding factor 1 in diagnosis of chronic lymphocytic leukemia/small lymphocytic lymphoma.
25587085 2015 LEF1 Targeting EMT in Prostate Cancer Invasion Is Regulated by miR-34a.
More...