Property Summary

NCBI Gene PubMed Count 20
PubMed Score 6.46
PubTator Score 4.34

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Asthma 349
Obesity 616
Disease Target Count P-value
ovarian cancer 8492 1.19965772500736E-8
posterior fossa group B ependymoma 1530 1.64440271225158E-8
intraductal papillary-mucinous adenoma (IPMA) 2956 4.87601078537222E-5
pituitary cancer 1972 8.71473075036062E-5
intraductal papillary-mucinous carcinoma (IPMC) 2988 3.39249778285189E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00140931041183025
Breast cancer 3099 0.00188288390154176
colon cancer 1475 0.00558550509341937
lung cancer 4473 0.0380013049589418
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0

Expression

Synonym

Accession Q9UJT9 B9EGF1 D6RDY7 O94926
Symbols FBL6
FBL7

Gene

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA EggNOG Inparanoid

Gene RIF (5)

PMID Text
25778398 the Skp1.Cul1.F-box protein complex subunit Fbxl7 modulates mitochondrial function by controlling the cellular abundance of survivin
25654763 Fbxl18 regulates apoptosis by mediating ubiquitin-dependent proteasomal degradation of the pro-apoptotic protein Fbxl7 that may impact cellular processes involved in cell cycle progression.
22306998 FBXL7 specifically interacts with Aurora A during mitosis but not in interphase, suggesting a regulatory role for FBXL7 in controlling Aurora A abundance during mitosis.
20418484 Observational study and genome-wide association study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MGANNGKQYGSEGKGSSSISSDVSSSTDHTPTKAQKNVATSEDSDLSMRTLSTPSPALICPPNLPGFQNG      1 - 70
RGSSTSSSSITGETVAMVHSPPPTRLTHPLIRLASRPQKEQASIDRLPDHSMVQIFSFLPTNQLCRCARV     71 - 140
CRRWYNLAWDPRLWRTIRLTGETINVDRALKVLTRRLCQDTPNVCLMLETVTVSGCRRLTDRGLYTIAQC    141 - 210
CPELRRLEVSGCYNISNEAVFDVVSLCPNLEHLDVSGCSKVTCISLTREASIKLSPLHGKQISIRYLDMT    211 - 280
DCFVLEDEGLHTIAAHCTQLTHLYLRRCVRLTDEGLRYLVIYCASIKELSVSDCRFVSDFGLREIAKLES    281 - 350
RLRYLSIAHCGRVTDVGIRYVAKYCSKLRYLNARGCEGITDHGVEYLAKNCTKLKSLDIGKCPLVSDTGL    351 - 420
ECLALNCFNLKRLSLKSCESITGQGLQIVAANCFDLQTLNVQDCEVSVEALRFVKRHCKRCVIEHTNPAF    421 - 490
F//

Text Mined References (21)

PMID Year Title
25778398 2015 The Proapoptotic F-box Protein Fbxl7 Regulates Mitochondrial Function by Mediating the Ubiquitylation and Proteasomal Degradation of Survivin.
25654763 2015 F-box protein Fbxl18 mediates polyubiquitylation and proteasomal degradation of the pro-apoptotic SCF subunit Fbxl7.
24486069 2014 Genetic predictors associated with improvement of asthma symptoms in response to inhaled corticosteroids.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22589738 2012 Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women.
22566634 2012 The genetic architecture of economic and political preferences.
22306998 2012 Novel E3 ligase component FBXL7 ubiquitinates and degrades Aurora A, causing mitotic arrest.
20418484 2010 Common variants associated with breast cancer in genome-wide association studies are modifiers of breast cancer risk in BRCA1 and BRCA2 mutation carriers.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18426905 2008 Downregulation of vertebrate Tel (ETV6) and Drosophila Yan is facilitated by an evolutionarily conserved mechanism of F-box-mediated ubiquitination.
More...