Property Summary

NCBI Gene PubMed Count 21
PubMed Score 6.84
PubTator Score 4.34

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
Breast cancer 1.300 1.9e-03
colon cancer -1.800 5.6e-03
ependymoma 1.100 5.6e-06
intraductal papillary-mucinous adenoma (... -1.400 4.9e-05
intraductal papillary-mucinous carcinoma... -1.400 3.4e-04
intraductal papillary-mucinous neoplasm ... -1.500 1.4e-03
lung cancer -1.500 3.8e-02
ovarian cancer -2.300 1.2e-08
pituitary cancer 1.400 8.7e-05

Protein-protein Interaction (2)

Gene RIF (5)

AA Sequence

MGANNGKQYGSEGKGSSSISSDVSSSTDHTPTKAQKNVATSEDSDLSMRTLSTPSPALICPPNLPGFQNG      1 - 70
RGSSTSSSSITGETVAMVHSPPPTRLTHPLIRLASRPQKEQASIDRLPDHSMVQIFSFLPTNQLCRCARV     71 - 140
CRRWYNLAWDPRLWRTIRLTGETINVDRALKVLTRRLCQDTPNVCLMLETVTVSGCRRLTDRGLYTIAQC    141 - 210
CPELRRLEVSGCYNISNEAVFDVVSLCPNLEHLDVSGCSKVTCISLTREASIKLSPLHGKQISIRYLDMT    211 - 280
DCFVLEDEGLHTIAAHCTQLTHLYLRRCVRLTDEGLRYLVIYCASIKELSVSDCRFVSDFGLREIAKLES    281 - 350
RLRYLSIAHCGRVTDVGIRYVAKYCSKLRYLNARGCEGITDHGVEYLAKNCTKLKSLDIGKCPLVSDTGL    351 - 420
ECLALNCFNLKRLSLKSCESITGQGLQIVAANCFDLQTLNVQDCEVSVEALRFVKRHCKRCVIEHTNPAF    421 - 490
F//

Text Mined References (22)

PMID Year Title