Property Summary

NCBI Gene PubMed Count 8
Grant Count 10
Funding $365,927.5
PubMed Score 9.94
PubTator Score 4.43

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

AA Sequence

MASVVVKTIWQSKEIHEAGDTPTGVESCSQLVPEAPRRVTSRAKGIPKKKKAVSFHGVEPQMSHQPMHWC      1 - 70
LNLKRSSACTNVSLLNLAAMEPTDSTGTDSTVEDLSGQLTLAGPPASPTLPWDPDDADITEILSGVNSGL     71 - 140
VRAKDSITSLKEKTNRVNQHVQSLQSECSVLSENLERRRQEAEELEGYCIQLKENCWKVTRSVEDAEIKT    141 - 210
NVLKQNSALLEEKLRYLQQQLQDETPRRQEAELQEPEEKQEPEEKQEPEEKQKPEAGLSWNSLGPAATSQ    211 - 280
GCPGPPGSPDKPSRPHGLVPAGWGMGPRAGEGPYVSEQELQKLFTGIEELRREVSSLTARWHQEEGAVQE    281 - 350
ALRLLGGLGGRVDGFLGQWERAQREQAQTARDLQELRGRADELCTMVERSAVSVASLRSELEGLGPLKPI    351 - 420
LEEFGRQFQNSRRGPDLSMNLDRSHQGNCARCASQGSQLSTESLQQLLDRALTSLVDEVKQRGLTPACPS    421 - 490
CQRLHKKILELERQALAKHVRAEALSSTLRLAQDEALRAKNLLLTDKMKPEEKMATLDHLHLKMCSLHDH    491 - 560
LSNLPLEGSTGTMGGGSSAGTPPKQGGSAPEQ                                          561 - 592
//

Text Mined References (9)

PMID Year Title
19389623 2009 Docking motif-guided mapping of the interactome of protein phosphatase-1.
18533145 2008 Targeted deletion of Tssk1 and 2 causes male infertility due to haploinsufficiency.
18495105 2008 TSKS concentrates in spermatid centrioles during flagellogenesis.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15044604 2004 Expression analysis of the human testis-specific serine/threonine kinase (TSSK) homologues. A TSSK member is present in the equatorial segment of human sperm.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11444856 2001 Identification and characterization of a novel human testis-specific kinase substrate gene which is downregulated in testicular tumors.