Property Summary

NCBI Gene PubMed Count 9
PubMed Score 9.94
PubTator Score 4.43

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Melanoma 711 0.0 0.5
Disease Target Count Z-score Confidence
Male infertility 206 3.471 1.7
Teratocarcinoma 8 3.415 1.7
Seminoma 15 3.113 1.6

Expression

Synonym

Accession Q9UJT2 Q8WXJ0 Testis-specific kinase substrate
Symbols TSKS1
TSSKS
STK22S1
PPP1R161

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

AA Sequence

MASVVVKTIWQSKEIHEAGDTPTGVESCSQLVPEAPRRVTSRAKGIPKKKKAVSFHGVEPQMSHQPMHWC      1 - 70
LNLKRSSACTNVSLLNLAAMEPTDSTGTDSTVEDLSGQLTLAGPPASPTLPWDPDDADITEILSGVNSGL     71 - 140
VRAKDSITSLKEKTNRVNQHVQSLQSECSVLSENLERRRQEAEELEGYCIQLKENCWKVTRSVEDAEIKT    141 - 210
NVLKQNSALLEEKLRYLQQQLQDETPRRQEAELQEPEEKQEPEEKQEPEEKQKPEAGLSWNSLGPAATSQ    211 - 280
GCPGPPGSPDKPSRPHGLVPAGWGMGPRAGEGPYVSEQELQKLFTGIEELRREVSSLTARWHQEEGAVQE    281 - 350
ALRLLGGLGGRVDGFLGQWERAQREQAQTARDLQELRGRADELCTMVERSAVSVASLRSELEGLGPLKPI    351 - 420
LEEFGRQFQNSRRGPDLSMNLDRSHQGNCARCASQGSQLSTESLQQLLDRALTSLVDEVKQRGLTPACPS    421 - 490
CQRLHKKILELERQALAKHVRAEALSSTLRLAQDEALRAKNLLLTDKMKPEEKMATLDHLHLKMCSLHDH    491 - 560
LSNLPLEGSTGTMGGGSSAGTPPKQGGSAPEQ                                          561 - 592
//

Text Mined References (10)

PMID Year Title