Property Summary

NCBI Gene PubMed Count 15
PubMed Score 18.52
PubTator Score 8.89

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (7)

Disease log2 FC p
gastric cancer 1.300 1.0e-03
group 3 medulloblastoma 1.200 2.6e-03
hepatocellular carcinoma 1.400 4.0e-06
lung cancer 1.100 3.8e-02
malignant mesothelioma 2.000 6.0e-08
osteosarcoma 1.084 8.8e-04
tuberculosis and treatment for 6 months -1.500 1.2e-05

Gene RIF (7)

AA Sequence

MSIVTVQLGQCGNQIGFEVFDALLSDSHSSQGLCSMRENEAYQASCKERFFSEEENGVPIARAVLVDMEP      1 - 70
KVINQMLSKAAQSGQWKYGQHACFCQKQGSGNNWAYGYSVHGPRHEESIMNIIRKEVEKCDSFSGFFIIM     71 - 140
SMAGGTGSGLGAFVTQNLEDQYSNSLKMNQIIWPYGTGEVIVQNYNSILTLSHLYRSSDALLLHENDAIH    141 - 210
KICAKLMNIKQISFSDINQVLAHQLGSVFQPTYSAESSFHYRRNPLGDLMEHLVPHPEFKMLSVRNIPHM    211 - 280
SENSLAYTTFTWAGLLKHLRQMLISNAKMEEGIDRHVWPPLSGLPPLSKMSLNKDLHFNTSIANLVILRG    281 - 350
KDVQSADVEGFKDPALYTSWLKPVNAFNVWKTQRAFSKYEKSAVLVSNSQFLVKPLDMIVGKAWNMFASK    351 - 420
AYIHQYTKFGIEEEDFLDSFTSLEQVVASYCNL                                         421 - 453
//

Text Mined References (16)

PMID Year Title