Property Summary

NCBI Gene PubMed Count 7
Grant Count 102
R01 Count 31
Funding $16,025,177.77
PubMed Score 365.88
PubTator Score 51.94

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytic glioma 1.500 0.039
ependymoma 1.600 0.013
oligodendroglioma 1.200 0.026
juvenile dermatomyositis 1.190 0.000
pancreatic ductal adenocarcinoma liver m... -1.530 0.004
group 4 medulloblastoma 1.300 0.019
lung carcinoma 1.200 0.000
Pick disease -1.700 0.000
progressive supranuclear palsy -1.500 0.010
ovarian cancer -2.000 0.000

Synonym

Accession Q9UJT0 Q5H8W8 Q8NEG3
Symbols TUBE
dJ142L7.2

Gene

Gene RIF (5)

PMID Text
23826228 HIV-1 Tat K29A, K50R, and K51R lysine mutations downregulate the proportion of soluble tubulin in cells, while the majority of other lysine mutations upregulate the percentage of soluble tubulin compared with the wild-type
20508983 Observational study of gene-disease association. (HuGE Navigator)
19851462 EB1 recognizes the nucleotide state of tubulin in the microtubule lattice
15698476 HIV-1 Tat K29A, K50R, and K51R lysine mutations downregulate the proportion of soluble tubulin in cells, while the majority of other lysine mutations upregulate the percentage of soluble tubulin compared with the wild-type
15691386 HIV-1 Tat K29A, K50R, and K51R lysine mutations downregulate the proportion of soluble tubulin in cells, while the majority of other lysine mutations upregulate the percentage of soluble tubulin compared with the wild-type

AA Sequence

MTQSVVVQVGQCGNQIGCCFWDLALREHAAVNQKGIYDEAISSFFRNVDTRVVGDGGSISKGKICSLKAR      1 - 70
AVLIDMEEGVVNEILQGPLRDVFDTKQLITDISGSGNNWAVGHKVFGSLYQDQILEKFRKSAEHCDCLQC     71 - 140
FFIIHSMGGGTGSGLGTFLLKVLEDEFPEVYRFVTSIYPSGEDDVITSPYNSILAMKELNEHADCVLPID    141 - 210
NQSLFDIISKIDLMVNSGKLGTTVKPKSLVTSSSGALKKQHKKPFDAMNNIVANLLLNLTSSARFEGSLN    211 - 280
MDLNEISMNLVPFPQLHYLVSSLTPLYTLTDVNIPPRRLDQMFSDAFSKDHQLLRADPKHSLYLACALMV    281 - 350
RGNVQISDLRRNIERLKPSLQFVSWNQEGWKTSLCSVPPVGHSHSLLALANNTCVKPTFMELKERFMRLY    351 - 420
KKKAHLHHYLQVEGMEESCFTEAVSSLSALIQEYDQLDATKNMPVQDLPRLSIAM                   421 - 475
//

Text Mined References (8)

PMID Year Title
20508983 2011 Centrosome-related genes, genetic variation, and risk of breast cancer.
19851462 2009 EB1 recognizes the nucleotide state of tubulin in the microtubule lattice.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12510196 2003 Epsilon-tubulin is required for centriole duplication and microtubule organization.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10620804 2000 Delta-tubulin and epsilon-tubulin: two new human centrosomal tubulins reveal new aspects of centrosome structure and function.