Property Summary

NCBI Gene PubMed Count 7
PubMed Score 368.07
PubTator Score 51.94

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytic glioma 1.500 3.9e-02
ependymoma 1.600 1.3e-02
group 4 medulloblastoma 1.300 1.9e-02
juvenile dermatomyositis 1.190 2.4e-12
lung carcinoma 1.200 8.2e-19
oligodendroglioma 1.200 2.6e-02
ovarian cancer -2.000 5.8e-07
pancreatic ductal adenocarcinoma liver m... -1.530 3.6e-03
Pick disease -1.700 9.4e-06
progressive supranuclear palsy -1.500 1.0e-02

Gene RIF (5)

AA Sequence

MTQSVVVQVGQCGNQIGCCFWDLALREHAAVNQKGIYDEAISSFFRNVDTRVVGDGGSISKGKICSLKAR      1 - 70
AVLIDMEEGVVNEILQGPLRDVFDTKQLITDISGSGNNWAVGHKVFGSLYQDQILEKFRKSAEHCDCLQC     71 - 140
FFIIHSMGGGTGSGLGTFLLKVLEDEFPEVYRFVTSIYPSGEDDVITSPYNSILAMKELNEHADCVLPID    141 - 210
NQSLFDIISKIDLMVNSGKLGTTVKPKSLVTSSSGALKKQHKKPFDAMNNIVANLLLNLTSSARFEGSLN    211 - 280
MDLNEISMNLVPFPQLHYLVSSLTPLYTLTDVNIPPRRLDQMFSDAFSKDHQLLRADPKHSLYLACALMV    281 - 350
RGNVQISDLRRNIERLKPSLQFVSWNQEGWKTSLCSVPPVGHSHSLLALANNTCVKPTFMELKERFMRLY    351 - 420
KKKAHLHHYLQVEGMEESCFTEAVSSLSALIQEYDQLDATKNMPVQDLPRLSIAM                   421 - 475
//

Text Mined References (8)

PMID Year Title