Property Summary

NCBI Gene PubMed Count 102
Grant Count 92
R01 Count 60
Funding $19,709,369.23
PubMed Score 438.85
PubTator Score 166.91

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma 2.138 0.001
atypical teratoid / rhabdoid tumor 3.000 0.000
breast carcinoma 1.300 0.013
lung adenocarcinoma 2.000 0.000
inflammatory breast cancer 1.300 0.028
ovarian cancer 1.200 0.000

Synonym

Accession Q9UJQ4 A2A2D8 Q540H3 Q6Y8G6
Symbols DRRS
HSAL4
ZNF797

Gene

Protein-protein Interaction (6)

Gene RIF (91)

PMID Text
26892498 review aims to summarize our current knowledge of SALL4, including a SALL4-based approach to classify and target cancers
26818834 SALL4 expression in squamous cell carcinoma of the esophagus may constitute a sign of dedifferentiation leading to poor patient prognosis
26791099 Study reports a novel heterozygous frameshift insertion in SALL4, c.410dupG (p.Gly138Argfs*43) segregating with Okihiro syndrome in a Brazilian pedigree with five affected individuals; the c.410dupG variant in SALL4 gene reported here is the cause of Okihiro syndrome without Duane anomaly, but with foot defect in one affected individual.
26779651 SALL4 and beta-catenin were positively correlated in colorectal cancer.
26750614 SALL4 was highly expressed and correlated with poor prognosis in SOC patients, promoting invasion and metastasis of OC cells.
26617716 By inhibition of SALL4 expression, the proliferation, invasiveness and drug resistance were dramatically reduced while apoptosis rate was up-regulated.
26407074 SALL4 could induce Epithelial-mesenchymal transition and resistance to antineoplastic drugs through the regulation of c-Myc. SALL4 and c-Myc may be novel therapeutic targets for endometrial cancer.
26317546 SALL4 has an oncogenic role in intrahepatic cholangiocarcinoma
26238082 The results show that miR-219-5p inhibited carcinogenesis of colon cancer by targeting oncogene Sall4
25919570 The mechanism through which miR-33b inhibits the stemness, migration and invasion of breast cancer cells is by targeting HMGA2, SALL4 and Twist1.
More...

AA Sequence

MSRRKQAKPQHINSEEDQGEQQPQQQTPEFADAAPAAPAAGELGAPVNHPGNDEVASEDEATVKRLRREE      1 - 70
THVCEKCCAEFFSISEFLEHKKNCTKNPPVLIMNDSEGPVPSEDFSGAVLSHQPTSPGSKDCHRENGGSS     71 - 140
EDMKEKPDAESVVYLKTETALPPTPQDISYLAKGKVANTNVTLQALRGTKVAVNQRSADALPAPVPGANS    141 - 210
IPWVLEQILCLQQQQLQQIQLTEQIRIQVNMWASHALHSSGAGADTLKTLGSHMSQQVSAAVALLSQKAG    211 - 280
SQGLSLDALKQAKLPHANIPSATSSLSPGLAPFTLKPDGTRVLPNVMSRLPSALLPQAPGSVLFQSPFST    281 - 350
VALDTSKKGKGKPPNISAVDVKPKDEAALYKHKCKYCSKVFGTDSSLQIHLRSHTGERPFVCSVCGHRFT    351 - 420
TKGNLKVHFHRHPQVKANPQLFAEFQDKVAAGNGIPYALSVPDPIDEPSLSLDSKPVLVTTSVGLPQNLS    421 - 490
SGTNPKDLTGGSLPGDLQPGPSPESEGGPTLPGVGPNYNSPRAGGFQGSGTPEPGSETLKLQQLVENIDK    491 - 560
ATTDPNECLICHRVLSCQSSLKMHYRTHTGERPFQCKICGRAFSTKGNLKTHLGVHRTNTSIKTQHSCPI    561 - 630
CQKKFTNAVMLQQHIRMHMGGQIPNTPLPENPCDFTGSEPMTVGENGSTGAICHDDVIESIDVEEVSSQE    631 - 700
APSSSSKVPTPLPSIHSASPTLGFAMMASLDAPGKVGPAPFNLQRQGSRENGSVESDGLTNDSSSLMGDQ    701 - 770
EYQSRSPDILETTSFQALSPANSQAESIKSKSPDAGSKAESSENSRTEMEGRSSLPSTFIRAPPTYVKVE    771 - 840
VPGTFVGPSTLSPGMTPLLAAQPRRQAKQHGCTRCGKNFSSASALQIHERTHTGEKPFVCNICGRAFTTK    841 - 910
GNLKVHYMTHGANNNSARRGRKLAIENTMALLGTDGKRVSEIFPKEILAPSVNVDPVVWNQYTSMLNGGL    911 - 980
AVKTNEISVIQSGGVPTLPVSLGATSVVNNATVSKMDGSQSGISADVEKPSATDGVPKHQFPHFLEENKI    981 - 1050
AVS                                                                      1051 - 1053
//

Publication (105)

PMID Year Title
26892498 2016 SALL4, the missing link between stem cells, development and cancer.
26818834 2016 The zinc-finger transcription factor SALL4 is frequently expressed in human cancers: association with clinical outcome in squamous cell carcinoma but not in adenocarcinoma of the esophagus.
26791099 2016 Novel frameshift variant in gene SALL4 causing Okihiro syndrome.
26779651 2016 Expression and clinical significance of SALL4 and ?-catenin in colorectal cancer.
26750614 2016 SALL4 is a marker of poor prognosis in serous ovarian carcinoma promoting invasion and metastasis.
26617716 2015 Inhibition of SALL4 suppresses carcinogenesis of colorectal cancer via regulating Gli1 expression.
26407074 2015 SALL4 as an Epithelial-Mesenchymal Transition and Drug Resistance Inducer through the Regulation of c-Myc in Endometrial Cancer.
26317546 2015 SALL4 is a novel therapeutic target in intrahepatic cholangiocarcinoma.
26238082 2015 miR-219-5p plays a tumor suppressive role in colon cancer by targeting oncogene Sall4.
25919570 2015 MicroRNA-33b Inhibits Breast Cancer Metastasis by Targeting HMGA2, SALL4 and Twist1.
More...