Property Summary

NCBI Gene PubMed Count 4
Grant Count 12
R01 Count 11
Funding $1,471,103.19
PubMed Score 7.13
PubTator Score 3.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

AA Sequence

MDLQGRGVPSIDRLRVLLMLFHTMAQIMAEQEVENLSGLSTNPEKDIFVVRENGTTCLMAEFAAKFIVPY      1 - 70
DVWASNYVDLITEQADIALTRGAEVKGRCGHSQSELQVFWVDRAYALKMLFVKESHNMSKGPEATWRLSK     71 - 140
VQFVYDSSEKTHFKDAVSAGKHTANSHHLSALVTPAGKSYECQAQQTISLASSDPQKTVTMILSAVHIQP    141 - 210
FDIISDFVFSEEHKCPVDEREQLEETLPLILGLILGLVIMVTLAIYHVHHKMTANQVQIPRDRSQYKHMG    211 - 280
//

Text Mined References (6)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
21642595 2011 BAD-LAMP is a novel biomarker of nonactivated human plasmacytoid dendritic cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.