Property Summary

NCBI Gene PubMed Count 4
PubMed Score 7.13
PubTator Score 3.13

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
astrocytoma 1493 1.14788609544445E-16
oligodendroglioma 2849 1.17194647708847E-14
atypical teratoid / rhabdoid tumor 4369 1.79817132511267E-11
pituitary cancer 1972 4.12455443164479E-8
non-small cell lung cancer 2798 1.2683995319827E-7
Breast cancer 3099 5.33791437684901E-5
glioblastoma 5572 1.20323155430127E-4
breast carcinoma 1614 1.30440809876063E-4
pancreatic cancer 2300 4.01405369962441E-4
medulloblastoma 1524 4.4380110132535E-4
medulloblastoma, large-cell 6234 8.22476989774637E-4
Pick disease 1893 0.00135303118423639
invasive ductal carcinoma 2950 0.00161121114854809
posterior fossa group A ependymoma 1511 0.00161401220985603
ductal carcinoma in situ 1745 0.00185537892287734
pilocytic astrocytoma 3086 0.00208441466793531
cutaneous lupus erythematosus 1056 0.00515925257070244
interstitial cystitis 2299 0.00548355600074097
primary pancreatic ductal adenocarcinoma 1271 0.00561455127502738
fibroadenoma 557 0.00783599243279036
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0141084613552115
ovarian cancer 8492 0.0335167502522213
chronic rhinosinusitis 512 0.0380591930850345
Disease Target Count Z-score Confidence
Danon disease 6 4.257 2.1

Expression

  Differential Expression (23)

Synonym

Accession Q9UJQ1 B4DHZ7 B7Z9Z9
Symbols LAMP-5
UNC-46
BADLAMP
BAD-LAMP
C20orf103

Gene

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

AA Sequence

MDLQGRGVPSIDRLRVLLMLFHTMAQIMAEQEVENLSGLSTNPEKDIFVVRENGTTCLMAEFAAKFIVPY      1 - 70
DVWASNYVDLITEQADIALTRGAEVKGRCGHSQSELQVFWVDRAYALKMLFVKESHNMSKGPEATWRLSK     71 - 140
VQFVYDSSEKTHFKDAVSAGKHTANSHHLSALVTPAGKSYECQAQQTISLASSDPQKTVTMILSAVHIQP    141 - 210
FDIISDFVFSEEHKCPVDEREQLEETLPLILGLILGLVIMVTLAIYHVHHKMTANQVQIPRDRSQYKHMG    211 - 280
//

Text Mined References (6)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
21642595 2011 BAD-LAMP is a novel biomarker of nonactivated human plasmacytoid dendritic cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.